KEGG   Aerococcaceae bacterium ZY16052: CL176_00630Help
Entry
CL176_00630       CDS       T05652                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
abae  Aerococcaceae bacterium ZY16052
Pathway
abae00473  D-Alanine metabolism
abae00550  Peptidoglycan biosynthesis
abae01100  Metabolic pathways
abae01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:abae00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CL176_00630
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CL176_00630
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CL176_00630
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:abae01011]
    CL176_00630
Enzymes [BR:abae01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CL176_00630
Peptidoglycan biosynthesis and degradation proteins [BR:abae01011]
 Precursor biosynthesis
  Amino acid ligase
   CL176_00630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AXY24649
UniProt: A0A347WHU2
LinkDB All DBs
Position
129519..130598
Genome map
AA seq 359 aa AA seqDB search
MKITLLYGGQSAEHDISIISAHNIAQSIMYDVYTVQPIYITRAGEWIKGPLIDTSLPNSD
LMRLVPAEEMTWGDDAKASTGQAMRPGELDREDNIVFPVLHGPNGEDGTIQGFLEVMGVP
YVGAGVTASAIGMDKILSKRIFDQIGLPQVPYHAFDHRLWREDQEEIIQRIEGSLLYPLF
VKPANMGSSVGISQVESSEALIQAIENALQYDHRIVVEQGISAVECEVAILGNEEAHISY
VGKLIKDVAFYDYEEKYINNRIEMEIPAILDPAVASKIQEYALRAYRAIDGCGLSRVDFF
VTSSQDIYINEINTMPGFTGLSMYPVLWEKTGLTQRNLVEELLQLALKKYEQKKGFKVE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaagataacgttactctacggcggacaaagtgctgaacatgatatttcaattatctca
gcacacaacatagctcagtccattatgtatgatgtatatactgttcagcctatttatatt
actcgggctggcgagtggattaaaggcccgttaatcgatacgagcttgccaaactctgat
ttgatgcgcctcgtaccggctgaagagatgacgtggggggatgacgctaaggcttcgact
gggcaagcgatgcgtccgggggaattggatcgggaggataatattgttttcccagtgctt
cacggacctaacggtgaagatggaacgattcaaggcttcttagaagttatgggtgttcct
tatgtaggcgcaggtgtgacggccagtgctataggtatggataagattttaagcaagcgt
atttttgaccaaattggtttgccacaagtgccttaccatgcttttgatcaccgcttgtgg
cgagaggatcaagaggaaattattcaacgcattgaaggctcactcctttatcctttattt
gtcaaaccggccaatatgggatcgagtgtgggaataagccaagtcgaaagcagtgaggca
ctgattcaagcgattgagaatgccttgcagtatgatcatcgcatcgtagtggagcaaggt
atttcggcggtggaatgtgaagtggcgattttaggtaatgaagaagcgcatattagttat
gtaggtaagttgattaaagatgtggccttctacgattatgaagagaaatatataaataat
cgcattgagatggagattccagcaatcttagaccccgcggtggcttctaagatacaagaa
tatgctttgcgggcttaccgtgccattgatggctgtggtttaagtcgggtggactttttt
gttaccagtagccaggatatttatatcaatgaaattaacacgatgccaggttttacaggc
ttgagtatgtatccggtgctttgggagaagacgggcttgacgcaaagaaatttagtggaa
gagttacttcaattagcgttgaagaaatatgaacagaaaaaaggattcaaggtagagtaa

DBGET integrated database retrieval system