KEGG   Aerococcaceae bacterium ZY16052: CL176_02465Help
Entry
CL176_02465       CDS       T05652                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
abae  Aerococcaceae bacterium ZY16052
Pathway
abae00040  Pentose and glucuronate interconversions
abae00051  Fructose and mannose metabolism
abae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CL176_02465
   00051 Fructose and mannose metabolism
    CL176_02465
Enzymes [BR:abae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     CL176_02465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AXY24980
UniProt: A0A347WIS3
LinkDB All DBs
Position
497210..498256
Genome map
AA seq 348 aa AA seqDB search
MKALQVINTKEMELVDIETPSPCKDEVLIKVAYCGVCGSDLARYFKGQVHKFPQILGHEF
SGIIESVGDSVKSIEVGDRVAVAPLKPCGKCHMCETGEPAMCTNYSFIGSREPGAMAEYV
VAPERNVMVIPDELSLKEAALVEPLTVAIHGVDRLKVESGDVALVLGSGTIGLLTIGVLR
AKGVKKIIATDLSEEKLKYAKNMGADVAIDTTEVTLDDYFKDQQLPDLVYETAGSPYTHV
EAFKFVRKKGQVCYIGTSTSEITFNHKEFELINRGELTVTGSWMSYSAPFPGKEWGAALN
YLANKEIMVKDLITGVHSLEDKSLPFNRLIDKDIVAVDEIYEISKEEE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctttgcaagtaatcaacactaaggagatggagttagtagatatagaaacacct
agtccttgtaaagatgaggtgctgataaaggtggcatattgtggagtttgtggatcagat
ttagcaaggtattttaaaggtcaagttcataagtttccacaaattttagggcatgagttt
tccgggataatagaatcagttggggattcagtgaaaagcattgaggtcggtgatcgagtt
gcagttgcgcctttaaaaccttgtgggaaatgccacatgtgtgagacaggcgaaccagct
atgtgtaccaattatagttttataggttcacgtgaacctggtgcgatggcagaatatgtt
gtagctccagaaaggaatgtgatggttattcctgatgagctttcattgaaagaagctgct
ttagtagaaccgttaactgttgctattcatggagttgatagacttaaagtagaatctggg
gatgttgctctagtgttaggatcaggaacgattggcttacttacaatcggtgtattacga
gcaaaaggcgtaaaaaaaatcattgcaacagatttaagtgaagaaaaattaaaatatgca
aaaaatatgggtgcagatgttgcgatagacactacagaagttactttagatgattatttt
aaagatcaacaattgccggatcttgtatatgagacagcgggatcaccgtatactcacgta
gaagcgtttaaatttgtgcgaaaaaaaggacaagtctgttatatcggtacaagtacaagt
gaaattacttttaaccataaagagtttgagttaattaatcgcggcgagttaacagttaca
ggctcttggatgtcttactcagcgccttttccaggaaaagaatggggtgctgcactaaat
tatttagctaataaagaaattatggtaaaggatcttataacaggcgtacatagtttagaa
gacaagtcattaccatttaatcgtttaatcgataaggatattgtagctgttgacgaaata
tacgagatttcaaaggaggaagaatag

DBGET integrated database retrieval system