KEGG   Aerococcaceae bacterium ZY16052: CL176_06060Help
Entry
CL176_06060       CDS       T05652                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
abae  Aerococcaceae bacterium ZY16052
Brite
KEGG Orthology (KO) [BR:abae00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:abae01001]
    CL176_06060
Enzymes [BR:abae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CL176_06060
Protein kinases [BR:abae01001]
 Serine/threonine kinases: Other
  Bacterial family
   CL176_06060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like APH Kdo FTA2 RIO1 Haspin_kinase Pkinase_fungal PIP49_C
Motif
Other DBs
NCBI-ProteinID: AXY25593
UniProt: A0A347WKI6
LinkDB All DBs
Position
complement(1280296..1282293)
Genome map
AA seq 665 aa AA seqDB search
MVEVGEKLSGRYVINQPIGQGGMANVYLAHDLILNRDVAVKVLRYDFQNDQDAIRRFQRE
AMSASQLLHHNIVEVYDVDEEQNEQYIVMEYVNGDDLKTFIRENAPISLELAVNIMSQIL
SAIDVAHRHGIIHRDIKPQNILMTENNQVKITDFGIAIALTDTSITQTNTLLGSVHYLSP
EQARGANATTKSDIYALGVVLYELITGSVPFDGESAVSVALKHFQEAFPRIRTQLDYVPQ
SLENVVLKATAKDPNDRYDNVQQMLNDLSTSLSANRMNEQAFEPSDMDQTIALTPLHPED
TEAVKDTTREQPLQAPEPLDEEAYQTFDVVEDINRPQKSRRWIRIGILMVVGLLIGLLGF
YTYNTFGRQVTVPDVSGMTREEAEQTLSSEDIAIANIIYQWHESIPTGNVVDTAPEQGSR
IERNSTVDLLVSNGPEQVEIGNYIGQDYESIRRLLTDAGFIVERRGLATNSPEQVGVILD
QSIAPGTAVVPGKTSITLTVGSSADTITMQDFYNLDSRVARNFAEEYGLYVEESYEYSEF
IPENQIVGQRPASGTPLEQGETIEIIISLGPETPQIRTSEVDVFLEYVPTYADNDTDQEN
PQPNTIQIFIGDKNRDINQVAEEFEITESTTRTLTLNIPENGSGQYRVLRDGEVIAESNE
VGAYE
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggttgaagttggagagaaattatccggtcgctatgtcatcaatcagccaatcggtcaa
ggtgggatggcgaatgtttacctggcacatgacttaattcttaaccgtgatgtcgctgtc
aaagtcttacgctacgacttccagaatgaccaagatgccatccgtcgctttcaacgggaa
gctatgtcagccagccaactcctacatcacaatattgttgaagtttatgacgttgatgaa
gaacaaaatgagcagtatattgtcatggaatacgttaatggcgatgatctgaagaccttt
attcgcgagaatgcaccgatttcactggaattagccgtgaacattatgagtcaaatatta
tccgccatcgatgtcgcccatcgccacggtattattcaccgggacattaaaccccagaac
attctcatgacagagaataaccaagtcaagataaccgacttcgggattgcgattgccctc
accgatacatccatcacccaaacgaataccttattaggctcggtgcattacttatcacca
gagcaggcccgcggggccaatgcgaccactaaatcagatatttatgccttaggggtcgtc
ttatatgaattgattacaggatccgtgccttttgacggggaatccgctgtatcggtagcc
ttgaagcatttccaagaagctttcccgcggattcgcacgcaattagattatgtgccgcaa
agcttagagaacgttgtcttaaaggccaccgccaaagatcccaatgatcgctatgacaat
gtgcaacagatgctcaatgatttaagcacgagtttaagtgccaatcgcatgaacgagcag
gcttttgaaccgagtgatatggatcaaacgattgccctgacgcccttgcatcctgaagac
actgaagcagtcaaagatacgactcgagaacagcctttacaggcaccggaacctttagat
gaagaagcctaccaaacctttgatgtggtggaagacattaaccgcccccaaaaatcaaga
cggtggattcgtataggcattcttatggttgtcggtctcttaatcggcctgcttggtttt
tatacttataatacctttggcagacaggtgaccgttcccgatgtgagtggtatgacgcgg
gaggaagcagagcaaaccttaagtagcgaagatattgcgattgccaatattatttaccaa
tggcatgaaagcattccaacgggcaatgtcgtcgatacagcccctgagcaaggtagccgg
attgagcgaaattctacggttgatttgctcgtcagcaatgggccagaacaggttgaaatt
ggcaattacataggccaagactatgaatctattcgcagattgctgactgatgctggtttt
attgtggaaaggcgtggcctagcaaccaattcgccagaacaagtaggtgtgattttagac
cagagtattgccccagggacagcggtggtaccagggaagacgtcaattaccttaacggtt
ggaagttcagccgatacgattactatgcaagatttttataatttagacagtcgggtagcc
cgtaatttcgccgaggaatacggtctatatgtagaagaatcctatgaatatagtgaattc
atccccgaaaaccaaattgttggccaaagaccggccagcggtacaccgcttgagcagggg
gagacgattgaaatcatcatctccttgggaccggaaacaccgcaaattcgcaccagtgaa
gtggatgtcttcctcgagtatgttcccacttatgcggacaatgataccgaccaagagaat
cctcaaccgaataccatccaaatcttcattggggataagaaccgcgacatcaatcaagtc
gccgaagagtttgaaattaccgaatcgacaacccgtaccttaacactcaacatccctgaa
aacggcagcggtcaataccgggtcttaagggacggggaagtcattgccgaaagtaatgaa
gtaggcgcctatgaatag

DBGET integrated database retrieval system