KEGG   Aerococcaceae bacterium ZY16052: CL176_07065Help
Entry
CL176_07065       CDS       T05652                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
abae  Aerococcaceae bacterium ZY16052
Brite
KEGG Orthology (KO) [BR:abae00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CL176_07065
Enzymes [BR:abae01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CL176_07065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like DAO FAD_binding_2 FAD_oxidored Thi4 FAD_binding_3 Lycopene_cycl NAD_binding_9 LPD7 Thioredoxin_9 NAD_binding_8 Amino_oxidase FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AXY25773
UniProt: A0A347WL16
LinkDB All DBs
Position
complement(1504562..1506097)
Genome map
AA seq 511 aa AA seqDB search
MALDQELKAQLKQYFALLEGPVVFGLSTDDSEDSQKVADFVHEVAQMSDQLSVVEKELPL
KPSFAVDTPDEETGIVFAGLPLGHEFSSLVLAILQVSGRAPKISDELKAQIQGIQQELHF
VTYVSLTCQNCPDVVQNLNIMARLNPNIHHTMVEGGMFRSEVEARNILAVPTIYLNDEEF
ASGRISIEKILENLGEEVAKADLSEKGTFDVLVVGGGPAGAAAAVYAARKGIEVGLVADE
FGGQVLDTLGIENFIGTEYIEGPQLMANMRRHVESYKVDIIEHQRVANVEREDSALTLTM
EDGQSLTAKTAVLATGARWRAINVPGEQEFKNKGISYCTHCDGPLYKDKVVAIIGGGNSG
IEAALDMAGLAKEVIVLEFLDTLKADQVLQDRLNELDNVRVVLNADTQAILGDGQVEQLV
YKDRESGEEHTLDIGGLFILVGLVPNNEWLPETIERNGRGEIIVDERGATSLEGVYAAGD
CTDQVFKQIIISSGSGATAALGAYDYLLRQG
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggcactagatcaagaattaaaagcccaactgaaacaatactttgccttactcgaaggc
cccgtagtcttcggtctttcaaccgacgacagcgaagattcacaaaaagtcgccgacttc
gtccatgaagtagcacagatgagcgaccaattaagcgttgttgagaaagaacttcccttg
aaaccaagctttgcagtggatacaccagacgaagagacaggtattgtctttgcggggctg
cccctcggacatgagttctcgtccttagtactggcgattctacaagtaagcggtcgggca
ccgaagatttcagatgaattgaaagcacaaattcaaggcattcagcaggagctccatttc
gtcacttatgtgagtttaacgtgtcagaattgcccggacgttgtgcagaacttaaatatt
atggcgcggttgaatccgaacattcatcatacgatggtggaaggcggcatgttccgttcg
gaagttgaagcgcgtaatattcttgcggtaccaacgatttacttgaatgatgaagaattc
gcaagtgggcggatttctatcgaaaagattctcgaaaacttaggcgaagaagtcgctaaa
gccgacttatctgagaaaggtaccttcgatgtcttagtggtcggtggaggtccagctggt
gcagctgcggcggtatatgcggcccgtaaaggcattgaggttggcttagtcgcagatgaa
tttggtggacaagtattggatacgttaggtatcgagaacttcattggtactgaatatatc
gaaggaccacaattgatggcaaatatgcgccgtcatgtagagtcgtacaaggtggatatt
atcgaacatcagcgtgtagccaatgttgaacgtgaagacagcgcattgaccttaacgatg
gaagacggtcaaagcctcacagccaaaaccgctgtgctagctacaggggcgcgttggcgt
gcgattaatgtgccaggtgagcaggaattcaagaataaagggatttcctactgtacccac
tgtgatggtcccctatacaaggacaaagttgtggctatcattggtggcggtaactctgga
attgaagcagccttagatatggcaggtttagccaaagaggtcattgtcttggaattcttg
gataccttgaaagctgaccaagtcctacaagatcgcttgaatgaactggataatgtccgt
gtcgttctcaatgctgatacgcaagccattttaggcgacggtcaagtagagcaattagtc
tacaaagaccgcgaaagtggtgaggagcacacgttagatattggtggattgttcattctg
gttggcttagtgccgaacaatgaatggttgccggagaccattgaacgcaatggccgcggt
gaaatcattgttgacgaacgcggtgcaacgagcttggagggtgtctatgcagccggagac
tgtacagatcaagtcttcaagcagattattatctcttctggttcaggggctaccgctgcg
ctgggagcttatgattacttattgcgtcaaggttaa

DBGET integrated database retrieval system