KEGG   Aerococcaceae bacterium ZY16052: CL176_09260Help
Entry
CL176_09260       CDS       T05652                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
abae  Aerococcaceae bacterium ZY16052
Pathway
abae00790  Folate biosynthesis
abae01100  Metabolic pathways
Module
abae_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:abae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CL176_09260 (folP)
Enzymes [BR:abae01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CL176_09260 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind DUF561
Motif
Other DBs
NCBI-ProteinID: AXY26171
UniProt: A0A347WM64
LinkDB All DBs
Position
1982876..1983808
Genome map
AA seq 310 aa AA seqDB search
MKFVTKQRVMAIDQPLICAILNVTPDSFSDGGQHNEVTQAVEKAKELIRQGADMLDIGGE
STRPGSTYVEIHEEINRVVPVIQAIREFSDIPISVDTWKAPVAEACLQAGANVINDITGL
IGDKAMAQVIAEHHAGLILMFNPVKIRPNHPAASRFPHFGESFLTAEELNSYANLDIIEL
MDIYFDKALALAEAAHIKPEQIMLDPGIGFGLTPEENLALINALPHLQGRGFLTYLGVSR
KRFLAQLVAEVGLPNDYTTEVGLQHVDTASAMISFLATQYGVHAIRVHSVQEHLLARQVA
LALKENQEMR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcgtaacgaaacaacgcgtcatggcgattgatcaacctttaatttgtgctatc
ttaaacgtcacaccggattccttctcagatggtggccagcacaatgaagtcacacaagcc
gttgaaaaggcaaaggagcttatccggcaaggagcggatatgttagatattggcggggaa
tccactcgtccaggttctacttatgtagaaatccacgaagaaattaaccgagtcgtcccg
gttattcaagcgattcgtgagttttctgatatacctatttctgtagatacttggaaagca
ccggtcgctgaggcatgtttacaagcaggagccaacgttatcaacgatattactggccta
atcggtgataaagcaatggcccaagtcatcgccgaacatcacgcaggattaatcctaatg
tttaatccggtcaaaatccgcccaaatcatcctgcggcaagccgttttccccatttcggt
gaaagctttttgacagcagaggagctgaacagctacgctaatcttgatattatcgaattg
atggatatatactttgacaaagccttggccctagccgaggcggctcatatcaagcctgag
cagattatgttagacccaggcatcggcttcggcttgaccccagaagagaaccttgcactc
attaacgcccttcctcatttacaaggtcggggcttccttacatatttgggtgtgtcacgc
aagcgtttcctcgctcaactggttgcagaggtcggcttgccgaacgattacacaaccgaa
gtgggcttgcaacatgttgataccgcctcggcaatgattagttttctggcaacgcaatac
ggcgtacacgccattcgtgtccattccgtacaggaacatttactcgccagacaagttgcc
ctagcgctcaaagagaatcaagaaatgaggtaa

DBGET integrated database retrieval system