KEGG   Aerococcaceae bacterium ZY16052: CL176_11405Help
Entry
CL176_11405       CDS       T05652                                 

Definition
(GenBank) DNA-binding response regulator
Organism
abae  Aerococcaceae bacterium ZY16052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AXY26554
UniProt: A0A347WN97
LinkDB All DBs
Position
complement(2425321..2426037)
Genome map
AA seq 238 aa AA seqDB search
MELLMIEDNASVSEMMSMFFENEGYQASFYDDGQAGYQAFMAEPNRWDIVILDLNLPSMD
GMQICREIRKASSNVPIIMLTARDSESDQVIGLEMGADDYVTKPFSPMTLLARIKALYRR
AQMGSVNQVQEADDAFDVRTNVLKINTATREAFYNDQLIENITPKEFDLLVMFAQNPKRV
FTREELLTSLWEDPFYGDERTVDAHIKKLRQKIETVGEQVIQTVWGVGYKYEEPGGKE
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggaactattaatgatcgaagataacgcctcagtgagtgaaatgatgtccatgtttttt
gagaatgaaggctatcaggcttccttttatgatgatggacaggcaggttaccaggccttt
atggcggagccgaaccgttgggatattgtcatcttagatttgaacttgcctagcatggac
gggatgcaaatttgccgtgaaatacgcaaggcatctagcaacgtaccgattattatgctc
actgcccgtgattcggagagtgatcaagttattggcttagagatgggtgcggatgattat
gtgaccaaaccattcagcccaatgacactcttggcgcggattaaggctttgtatcgccgt
gcccaaatgggttcagttaatcaggtgcaggaagctgatgatgcctttgatgtgcggacg
aatgtgctgaaaatcaatacagccactcgggaagctttctataacgaccaattaattgag
aatatcaccccgaaagaatttgatttactagtaatgtttgcccagaatcctaagcgtgtc
tttacgcgcgaagagttattgacgagtctatgggaagatcctttctatggggatgagcgc
acagttgacgcacatattaagaagttgcgccagaagattgaaacggtaggtgaacaagtc
atccaaaccgtttggggtgtaggctataaatatgaggagcctggtggcaaagaatga

DBGET integrated database retrieval system