KEGG   Aerococcaceae bacterium ZY16052: CL176_12005Help
Entry
CL176_12005       CDS       T05652                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
abae  Aerococcaceae bacterium ZY16052
Pathway
abae00500  Starch and sucrose metabolism
abae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CL176_12005
Enzymes [BR:abae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CL176_12005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: AXY26664
UniProt: A0A347WNK7
LinkDB All DBs
Position
complement(2558177..2559655)
Genome map
AA seq 492 aa AA seqDB search
MAFNTAVMQYFEWYLDDDGKLWQQLAEDAEHLNELGITHLWMPPAFKGTGTNDVGYGVYD
LYDLGEFDQQGTVRTKYGTKDEYIQAIRALKDQGIKPIADVVLNHRANGDEKERFPVLKM
DPNNRQQPISDVYEIEGWTHFTFPGRKGKYSDFTWHYYHFSGIDYDALNEETGIFMIMDE
NHGWADNESVDDEKGNYDYLMFCDVDYSEPEVVEETLKWVEWYIEETEVEGFRLDAIKHI
DRDFMEQFIKHVKEKYGDDFYVFGEYWDPDYDGEGGYLQDVDYIFKLVDVSLHNNFFMAS
KAGGSYDMRKILDGSLLNEQPWNAVTFVENHDTQWGQSLEASVEPWFKPLAYAMILLLQD
GNPTIFYGDYYGVKNEHPFDGLQYELDGLLYLRKYHAYGEEIRYFDDAQCIGWTRLGNDE
FPNGLAVIMTNGDMSEKQMHMGRANSGKKFVDYLGNNDAVVEIDENGDGLFPVGPGSVSV
WINQEAVDNYQA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcttttaatacggcagtaatgcaatattttgagtggtatttagatgatgatggaaag
ctctggcaacaacttgctgaggatgctgaacatttgaatgaattgggcataacccatcta
tggatgcctccggcttttaaaggtaccggaacgaatgatgtaggttatggggtgtatgac
ttatatgatttgggtgaattcgaccaacaaggaactgttcggactaaatacggtacgaaa
gatgagtatatacaagcaatccgagctttgaaagatcaaggaatcaaaccgattgcagat
gtggtgttgaatcaccgagctaatggggatgaaaaggaacgctttcccgtcctgaagatg
gatccaaataatcgccaacaaccaatttctgatgtttatgaaattgagggctggactcat
ttcactttcccaggacgcaaggggaaatatagtgattttacttggcactattatcacttt
tccggtattgattatgatgcattaaatgaagagaccggcatctttatgattatggatgag
aatcatggttgggctgacaatgaatcagtcgatgacgaaaaaggaaactatgattatctc
atgttctgtgacgtggattatagtgagccagaggttgttgaagagactttaaaatgggtc
gagtggtatattgaagaaacagaagttgaaggtttccgtctagacgctatcaaacacatt
gaccgtgattttatggagcaatttattaaacatgtgaaagaaaaatacggagatgatttc
tatgtgtttggtgaatattgggatcccgattatgatggtgagggtggatatttacaagat
gtggattatatatttaaattggtagatgtctccttacataataatttcttcatggcgagt
aaagcaggtggaagttatgatatgcgtaaaatcttagatggaagtctccttaacgagcag
ccttggaatgccgttacctttgtagaaaatcatgatacccagtgggggcaatcactggaa
gcgtcggttgagccatggttcaagccattagcttatgcgatgattttactgttacaagat
ggtaaccctacgattttttatggggattattatggtgtgaagaatgagcatccatttgat
ggcttacagtatgaattagatggtttgctttatttgcgtaagtatcatgcctatggagaa
gaaatacgttatttcgatgatgcacagtgtattggttggacccgtttgggtaacgatgaa
tttccgaatggtctagccgtaattatgaccaatggggatatgagtgaaaagcaaatgcat
atgggccgggcaaattcaggcaaaaaatttgttgattatttgggaaataatgatgcagtt
gtagaaatcgatgagaatggagacggtctgtttccagtggggccaggatctgtttcagta
tggatcaaccaggaagccgttgacaattaccaagcataa

DBGET integrated database retrieval system