KEGG   Actinobacteria bacterium IMCC26256: IMCC26256_11645Help
Entry
IMCC26256_11645   CDS       T03963                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
Organism
abai  Actinobacteria bacterium IMCC26256
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AKL72940
UniProt: A0A0G3V0G9
LinkDB All DBs
Position
complement(663076..664527)
Genome map
AA seq 483 aa AA seqDB search
MTDFKELFIGGEMVAPDGQGRIEVISPVTEEVYGSVPDASTADIDRAVSAARNAFDNGPW
PRMTPDERADAISRLSASLQARAMEIADVITNENGSVKSFSIMGQVFASTMVLDTYAGIA
RTYEFENRRAGALGGDVRVRRAPVGVAAGIIPWNVPLYITAMKLGPALASGSTIVLKPAP
ETPLDAYLFADAVMEAGIPEGVINVVAAGREVSEYLVAHPQVDKVSFTGSTAVGRRVASI
CGDQIKRCTLELGGKSAAIILDDVVLDDALLDQLLMAGLMNNGQVCGAQSRILVPRARYS
EIVEAIGDGMSKMIVGDPNEDSSQLGPLVAERQRTRVLGYIEAGKSEGARVVVGGGRPDD
LDKGWYVSPTLFADANNQMKIAREEIFGPVLTAIPYDTEAEAVAIANDSDYGLCGSVWTS
DIEHGGQIAAQVRTGVVAINSATILDFNAPFGGFKNSGLGRELGPEGLDAYTELQSIILP
ASG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgactgacttcaaagaattattcatcggcggagagatggttgctccagatgggcagggg
cgcatagaggtcatctcccccgttactgaagaggtctacggatctgtgcccgacgcaagt
actgccgatatcgaccgtgcagtatccgccgcacgcaatgctttcgataacggcccctgg
ccgcgcatgactccagacgagcgagccgacgccatctctcgactctcggcatcactacag
gcacgcgcaatggagattgcagacgtaattacaaacgagaacggatcagttaagtcgttc
tcaatcatgggtcaggtattcgcctccacaatggtgctcgacacctatgccggcatcgca
cgcacttatgagtttgagaaccgtcgcgccggcgcactcggtggcgatgtacgcgttcgc
cgtgcaccagtcggggtagccgccggaataatcccctggaacgttcccctctacatcacc
gccatgaaacttggccccgcgcttgcatcaggatcaaccattgtcttgaagccagcccct
gagacgcccctagatgcttacctatttgcagatgcagtaatggaggcaggaatccccgaa
ggagtaatcaatgtcgtcgctgccgggcgcgaagtaagcgaatacctagttgctcaccct
caggttgacaaggtctcattcaccggcagcaccgccgttggccgtcgcgtcgcgtcaatc
tgtggagatcagatcaagcgctgcactcttgaactaggtggaaagtcagcagcgattatt
ctcgacgacgtagtcctcgatgacgcactgctcgaccaacttctaatggctggcctaatg
aacaacggacaggtttgcggtgcgcagtcaagaatcctcgtcccccgtgcgcgctactca
gagattgttgaggcaatcggagatggcatgtcaaagatgattgtcggagaccctaacgaa
gactccagccaacttgggccgctagttgccgagcgccagcgcactcgcgttcttgggtat
atcgaggcaggtaagtccgagggcgcaagagttgtagtgggcggaggccgacctgacgat
ctcgataaaggttggtacgtgtcaccaacactcttcgcagacgccaataaccaaatgaag
attgctcgcgaggagatcttcggaccagtgctaactgcgattccttacgacacggaggct
gaggctgtggcgattgccaacgactccgattacggcctatgtggttcggtgtggacctca
gatattgagcatggaggccagattgctgctcaggttcgcaccggagttgttgccattaac
tctgcaaccatccttgacttcaatgctcccttcggaggattcaagaactctggactcggg
cgcgagctcggcccagaggggctggatgcatataccgaacttcagtccatcatcctcccc
gcttctggctaa

DBGET integrated database retrieval system