KEGG   Acinetobacter baumannii BJAB0868: BJAB0868_01135Help
Entry
BJAB0868_01135    CDS       T02728                                 

Definition
(GenBank) Cell division protein FtsI/penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
abaj  Acinetobacter baumannii BJAB0868
Pathway
abaj00550  Peptidoglycan biosynthesis
abaj01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:abaj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BJAB0868_01135
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BJAB0868_01135
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:abaj01011]
    BJAB0868_01135
Enzymes [BR:abaj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BJAB0868_01135
Peptidoglycan biosynthesis and degradation proteins [BR:abaj01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BJAB0868_01135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer Stimulus_sens_1
Motif
Other DBs
NCBI-ProteinID: AGQ09685
LinkDB All DBs
Position
complement(1209911..1211929)
Genome map
AA seq 672 aa AA seqDB search
MKQHFPLKDIQQEKRIYRGRIFFAVGLVIICLLVLASRYAYLQIFHYDEFSTASDKNRIR
LQPLPPARGYIYDRNGVLLADNYPVFTATLSKADVENVDTVIEQLQPILELTQEDVDRFK
SRIKTARKTERVAIKLNLTETNIAKFSEVKYKFPGVRIETQMTRYYPHGDLFAHVIGYVG
RINDKELKSIDKDLYAGTNLIGKIGVEKSYEDLLHGTPGYESVEADAHSNILRHLGRKDP
TRGNDLYLSLDYGLQVVASQQLAGRRGAIVAIDPRTGEILALVSSPSFNPNLFVTGINHK
DYSSLRDNIDQPLYNRAVQGVYPPGSTIKPMEAMGGLHYGIVDWATAISDPGYFHLPGDS
HKFRDWKKTGHGIVNMHKAIIMSCDTYFYILANQMGIDQMNQWMRQFGFGQKTGVDLPSE
SEGLYPNPEWKMRTRKSKWMKGETISVSIGQGAFTATPLQLAMATAITANHGSHVVPHVL
RATHGAKPFTVRNAPDGKINFNGTDEDWVKMREAMIDVIQSGTGRGIRTPLYQIAGKTGT
AQVKSIAQGKRYNEAALSERQLDHGLFVGFAPADKPEIAIAVIWENGRHGGSAAQLAKPV
FDYWLLTRKKNPIRPANHQVNGGLMTAGIKPGELPSGNESASSTPATSAPTSAAASTPQA
TPTRPATNEVDE
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcactttcctttaaaagatatccagcaagaaaagcgcatttatcgaggtcgt
atattttttgccgtagggcttgtgattatctgtttattggtactagccagccgatacgct
tatctacaaatttttcattatgatgagttctcgacagcatcggataaaaaccgtattcgc
ctacaaccccttccacctgctcgtggttatatttatgaccgcaatggggttttactggca
gataactaccctgtttttactgcaacattaagtaaagcagatgttgagaacgttgatacc
gttattgaacaattacagcctattttagagctcactcaagaagatgtagatcgttttaaa
agccgtattaaaacagcacgtaaaactgaacgtgtggccattaaactgaatttgactgag
acaaatattgccaagtttagtgaagttaaatacaaatttcctggggttagaattgaaacc
caaatgacgcgctattatccacatggtgatttatttgctcacgtgattggatatgttggc
cgtattaacgataaagaattaaaaagtattgataaagatttatacgctggaacaaacctg
attggtaaaattggtgtagaaaaaagctatgaagatttacttcatggaacacctggttat
gagtctgtagaagcagatgctcatagtaatattttgcgtcacctaggccgtaaagaccca
acccgtggtaatgatctctacttatcattagattatggtttgcaagttgtcgcatcacaa
cagctcgcaggtcgacgtggtgcaattgttgcgatagacccacgcaccggtgaaattctt
gcgttggtttcaagcccaagctttaatcctaacttatttgtgacgggtattaatcataaa
gattatagttctctacgtgacaatatagatcagcctctttataaccgtgcagtacaaggt
gtataccctcctggttcaaccattaagccaatggaagcgatgggcggtttacattatgga
attgttgattgggctactgctatttccgaccctggttatttccatttaccgggtgactca
cacaaattccgtgactggaaaaaaaccggccatggcatcgtgaacatgcacaaagccatt
atcatgtcttgtgacacctatttttatattttggccaatcaaatgggcatcgatcagatg
aaccaatggatgcgccaatttggctttggccaaaaaacaggtgtcgatttaccaagtgaa
agtgaaggcttatatccaaatcctgaatggaaaatgcgtacacgcaaatccaaatggatg
aaaggtgaaacgatttcagtcagtattggtcaaggtgcatttaccgcaactcctttacaa
ctcgccatggcaactgccattacggcgaaccatggctcgcatgtagttccacatgtttta
cgtgcaacccatggtgcaaaaccttttaccgtacgtaatgcacctgatggaaaaattaat
ttcaatggtacagatgaagattgggtaaaaatgcgagaagccatgattgatgtaattcaa
tcaggtactggtcgtggcatccgtacaccgctctatcaaattgccggaaaaacaggtaca
gcacaggttaaaagtattgctcaaggtaaacgttataacgaagctgcgcttagtgaacgc
caacttgaccacggtctttttgttggctttgctccggctgataaaccagaaatcgctatt
gcagttatttgggaaaatggccgtcatggtggttcagcagcccaacttgctaaacccgtg
tttgattactggttattaacccgtaagaaaaatccgattcgaccagccaaccatcaggtt
aatggtggcttgatgaccgctggaattaaaccgggtgaactcccaagtggtaatgaaagt
gccagctctactcctgcgacctctgctccgacttccgcagcagcctctactccacaggca
acaccaactcgtcctgctacaaacgaggtcgatgaataa

DBGET integrated database retrieval system