KEGG   Acinetobacter baumannii BJAB0868: BJAB0868_01297Help
Entry
BJAB0868_01297    CDS       T02728                                 

Definition
(GenBank) Alkyl hydroperoxide reductase, large subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
abaj  Acinetobacter baumannii BJAB0868
Brite
KEGG Orthology (KO) [BR:abaj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BJAB0868_01297
Enzymes [BR:abaj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BJAB0868_01297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO FAD_binding_3 Thi4 K_oxygenase AlaDh_PNT_C NAD_binding_8 Cytochrom_C_2 FMO-like Spermine_synth Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AGQ09846
LinkDB All DBs
Position
complement(1377203..1378768)
Genome map
AA seq 521 aa AA seqDB search
MLDQNIKTQLKAYLERLESPIELVAALDESDKAAQIKELVTEIAELSDKVTARFDGNNTR
RPSFGVAKAGEQPRVFFAGLPMGHEFTSLILALLQVSGYAPKVSDEVLNQIKGLNLKANF
DVFVSLSCHNCPDVVQALNLIAIYNPNTTATMIDGAFFQDEVEQRKIMAVPMVFQDNEHI
GQGRMTLEEIVAKLDTNSAEKDAAALNAKDAFDVLVIGGGPAGATAAIYAARKGINTGIV
AERFGGQVMDTMDIENFTSVQKTQGPKFAAEMEAHVREYDVDIMNLQRVSKITGADQTAN
GLVEVELENGAKLESKTVILSTGARWREMNVPGEAEYRTRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLVEFDTKLRADQVLQNKLNSLPNTTVIMNALSTEVLGD
GSQVTGLKYKDRATDGEHVVELAGIFVQIGLLPNTDFLKDSEVELTNRGEIIVNDRNETN
VKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYIIRSGQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaaaacattaaaactcaattaaaagcttacctagaacgtttagaaagtcca
atcgaattagttgctgctttagatgaatcagacaaagctgctcaaattaaagaattagta
actgaaatcgctgagctttctgacaaggtaacagcccgttttgacggtaataatacacgt
cgtccaagctttggtgtggctaaagcaggtgaacagcctcgtgtgttctttgcaggctta
ccaatgggccatgagtttacgtctttgatcttggctttgttacaagtgtctggctatgca
cctaaagtgtcggatgaagtgcttaaccagattaaaggcttaaacctcaaagctaacttt
gatgtgtttgtttcgcttagctgtcataactgtccggacgtggtacaggcacttaacctg
attgccatttataacccgaacaccacggcaaccatgattgatggtgcattcttccaagac
gaagtggaacaacgcaaaatcatggctgtaccgatggtcttccaggacaatgaacacatt
ggtcaaggtcgtatgacgcttgaagagattgtggcaaaacttgataccaattcagctgaa
aaagacgcagcagcactcaatgccaaagatgcgtttgatgtattggtgattggtggtgga
cctgcgggtgcaacagctgcaatctatgcggcacgtaaaggcattaacacaggtatcgtg
gctgaacgctttggtggtcaggtcatggacaccatggatattgaaaacttcacttctgtg
caaaagacccaaggtcctaagtttgctgctgaaatggaagcacatgttcgtgaatacgat
gtggatatcatgaacctgcaacgtgtcagcaaaatcactggtgcagaccaaacagcaaat
ggcttggttgaagttgaacttgaaaacggtgcaaaacttgaatcgaaaactgtgatcctt
tcaacaggggcacgttggagagaaatgaatgtacccggtgaagctgaataccgtacccgt
ggtgtagcgtactgtccacactgtgatggtccattgttcaaaggcaaacgtgttgctgtg
attggtggtggtaactcaggtgttgaagcggcgattgaccttgcaggtattgttgagcat
gtaactctggttgagtttgacactaaacttcgtgctgaccaagtcttgcaaaacaagtta
aatagcttgccaaacaccaccgtgattatgaatgcattaagcacagaagtattgggtgac
ggttcacaagtaaccggtcttaaatataaagaccgtgcaactgatggagagcatgtggta
gagcttgcagggatctttgtacagattggtttacttccaaacactgacttcttaaaagac
agtgaggttgagttaaccaatcgtggagagatcattgtcaatgaccgcaacgaaaccaat
gtaaaaggtgtatttgctgcaggtgactgtaccactgtaccttacaagcagatcattatt
gctacaggtgaaggcgctaaagcatcactctctgcgtttgattacatcattcgttctggg
cagtag

DBGET integrated database retrieval system