KEGG   Acinetobacter baumannii BJAB0868: BJAB0868_02725Help
Entry
BJAB0868_02725    CDS       T02728                                 

Definition
(GenBank) Monomeric isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
abaj  Acinetobacter baumannii BJAB0868
Pathway
abaj00020  Citrate cycle (TCA cycle)
abaj00480  Glutathione metabolism
abaj01100  Metabolic pathways
abaj01110  Biosynthesis of secondary metabolites
abaj01120  Microbial metabolism in diverse environments
abaj01130  Biosynthesis of antibiotics
abaj01200  Carbon metabolism
abaj01210  2-Oxocarboxylic acid metabolism
abaj01230  Biosynthesis of amino acids
Module
abaj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abaj_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:abaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BJAB0868_02725
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BJAB0868_02725
Enzymes [BR:abaj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BJAB0868_02725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AGQ11274
LinkDB All DBs
Position
complement(2882139..2884376)
Genome map
AA seq 745 aa AA seqDB search
MAGEKSTIIYTLTDEAPLLATYSLLPIIETFTKPAGIEIVKSDISVAARVLAEFADYLSE
EQKVSDNLAELGRLTQDPDTNIIKLPNISASVAQLTACIKELQSKGYAIPDYPENPATEE
EKTIKARYGKCLGSAVNPVLREGNSDRRAPAAVKNYAKKHPHSMSEWKQWSQTHVSHMEE
GDFYHGEKSMTLDRPRNVKMELITNSGKSIVLKPKVALQEGEIIDSMFMSKKALCDFYEK
QLDDCREAGILFSLHVKATMMKVSHPIVFGHCVKIYYKEAFEKHGKLFDELGINVNNGMA
GLYEKIETLPTSLREEIIEDLHACQEHRPALAMVDSAKGITNFHSPNDIIVDASMPAMIR
AGGKMWGADGKQYDAKAVMPESTFARIYQEMINFCKWHGNFDPKTMGTVPNVGLMAQKAE
EYGSHDKTFEIPEAGIANITDLDTGEVLLTQNVEEGDIWRMCQVKDAPIRDWVKLAVTRA
RNSGMPAIFWLDPYRPHENELIKKVQKYLKDHDTTGLDIQIMSQVRAMRYTLERVVRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEEN
HLRWDSLGEFLALAVSLEEMGIKENNARAKLLAKTLDEATGKLLDNDKSPSRRTGELDNR
GSHFYLSLYWAEALAAQNEDAELKAKFAPLAKALAENEQKIVAELAQVQGKPADIGGYYA
VDPAKVSAVMRPSATFNAALSTVQA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgaaaagtcaaccatcatttacacactgactgacgaggcgccattattggcg
acttattcgctactgccgatcattgagacctttactaagccagctggtatcgagattgtt
aaaagtgacatctctgtagctgcacgtgtgctcgcagaattcgctgactacctaagtgaa
gagcaaaaggtatccgacaaccttgctgagctaggtcgtcttacacaagatccagatact
aacattatcaaactcccaaatattagtgcctctgttgcgcaattgacagcatgtattaaa
gaacttcaatctaaaggttatgcaattcctgactatccggaaaacccagcgactgaagaa
gaaaaaacaatcaaagctcgttatggcaaatgcctaggttcagcagtaaaccctgttctt
cgtgaaggtaactctgaccgtcgtgctcctgctgccgttaaaaattacgctaagaaacac
cctcactcaatgagcgagtggaaacaatggtcgcaaactcacgtttcacacatggaagaa
ggtgacttctaccacggtgaaaagtcaatgacacttgaccgtccacgcaatgtaaaaatg
gaacttatcacaaacagtggtaagagcattgttcttaagccaaaagttgcgcttcaagaa
ggcgaaatcattgactcaatgttcatgagcaaaaaagcgctttgcgacttctatgagaaa
caacttgatgactgccgtgaagcaggaattttattctcattacacgtaaaagcgacaatg
atgaaagtttcacacccgatcgttttcggtcactgtgtgaaaatctactataaagaagct
ttcgaaaaacacggtaagttgtttgacgaattaggtattaacgtaaataacggtatggct
gggttatacgagaaaatcgaaactcttccaacctcattacgtgaagaaatcattgaagat
ttacatgcttgccaagaacaccgtcctgcacttgcgatggttgactcagcaaaaggtatc
actaacttccattcacctaacgacatcatcgtagatgcttctatgcctgcaatgatccgt
gctggtggtaaaatgtggggtgctgatggtaagcaatacgatgctaaggcagtaatgcca
gaatcaacatttgcccgtatttaccaagaaatgatcaatttctgtaaatggcatggtaac
tttgatccaaaaacaatgggtacagtaccaaacgttggtttgatggctcaaaaagctgaa
gaatacggttctcacgacaagacttttgaaattcctgaagcaggtattgcaaacattact
gatcttgacactggtgaagtgttattgactcaaaatgttgaagaaggcgatatctggcgt
atgtgtcaggtgaaagacgctccgattcgtgactgggtaaaacttgcagtaactcgtgca
cgtaactcaggcatgcctgcgatcttctggcttgacccatatcgtccacacgaaaatgaa
ttgatcaagaaagtacagaagtacttaaaagatcacgatacgactggtcttgatatccag
atcatgtctcaagtacgtgcaatgcgttacacacttgagcgtgtagttcgtggcctcgat
acaatttctgtaaccggtaacatcttacgcgactacttaactgacttgttcccaattatg
gaacttggtacttctgcgaaaatgttgtctatcgttccgcttatggcgggtggtggcatg
tacgaaactggtgcgggtggttcagcacctaaacacgtacaacaacttgttgaagaaaac
cacttacgttgggattcgcttggtgagttccttgcgcttgcagtttctctagaagaaatg
ggtattaaagaaaataatgctcgtgcgaagttacttgcgaagacacttgatgaagcgact
ggtaaattgcttgacaatgacaagtctccatcacgtcgtacaggcgaacttgacaaccgt
ggcagtcacttctacttgtcactttactgggcagaagcacttgctgcacagaacgaagat
gctgagttgaaagctaaatttgctccacttgcaaaagcattagctgaaaacgaacagaag
atcgttgctgagcttgctcaagtacaaggtaaaccagctgatatcggtggttactatgca
gttgacccagcgaaagtaagcgctgtaatgcgtccaagtgctacatttaatgcagcgctt
tcaactgttcaggcttaa

DBGET integrated database retrieval system