KEGG   Acinetobacter baumannii BJAB0868: BJAB0868_02727Help
Entry
BJAB0868_02727    CDS       T02728                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
abaj  Acinetobacter baumannii BJAB0868
Pathway
abaj00550  Peptidoglycan biosynthesis
abaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abaj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BJAB0868_02727
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:abaj01002]
    BJAB0868_02727
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:abaj01011]
    BJAB0868_02727
Enzymes [BR:abaj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BJAB0868_02727
Peptidases and inhibitors [BR:abaj01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BJAB0868_02727
Peptidoglycan biosynthesis and degradation proteins [BR:abaj01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BJAB0868_02727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AGQ11276
LinkDB All DBs
Position
2886653..2887972
Genome map
AA seq 439 aa AA seqDB search
MKFFLSLFTLFSIFCTTLTNAALLNIASESVEAAAWTIVDTQSGQIIAEHNSHVQRAPAS
LTKMMVAYIALKEIKAGKLKLNEVITATPVVSVVQWDESQMYLKAGEQISVDQLLAGLIV
MSANDAAVTLAEKISGDVPHFVQRMNQEAQALGMKDTHFSNPAGITMPDHYTTAHDLSLL
SQAVIHQTPEYLHYSKMPSFSYNQRFHHATNLALKYDPSVDGLKTGYTKAAGYNLALTAS
RPSFSPNLPQRRLLVIVLGTPSAVKRAEIADKLMNLAYAYTRDEVVIPEQKLIAELPVIK
STLKMFKVETKQPTIVTTSLYAEPTPIDLNTFDYATQRIQVLDSNQQPKVIAPLETTQTR
VNIQLNEQKLTAPLMKAMNLATVSIYQNNQLIRSLQIENDVHIEEANIFQRIMMWFSSLF
SIFSSSEHSAAKLYPIDSH
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattcttcctatctctttttacgctgtttagtattttctgtactactcttaccaat
gctgctctacttaatattgcttctgaaagtgttgaagccgctgcatggacaattgtagat
acccaatctggtcaaattattgctgagcataatagtcatgtacaacgtgcgccagcatct
ttaaccaaaatgatggtggcctacattgcattaaaagagattaaggctggaaagttaaaa
ctgaacgaagtcattactgcaacaccagtcgtaagcgtggtgcagtgggatgaatcacaa
atgtacctcaaagcgggcgagcaaatttcagttgatcagctcttggctggtttaattgtt
atgtctgcaaatgatgcagctgtgactttggctgaaaaaatttctggtgatgtgcctcat
ttcgtacagcgtatgaatcaagaagcacaagcactgggtatgaaagacacgcactttagt
aatcctgctggtattacaatgccggatcattacacgacagctcatgatttgagcttatta
agtcaggcagtgattcaccagacccctgaatatttacattattcgaaaatgccgagcttt
agctacaatcaacgttttcaccatgcgacgaaccttgcgctcaaatatgatccatctgta
gatggcttaaaaactggctataccaaagcagcaggttataacttggctctaacagcttca
cgcccttcattttcaccgaacttaccgcaaagacgtttactggtaattgtcttaggtaca
ccaagtgccgtgaaacgtgctgaaattgcagataaattaatgaatcttgcttatgcttat
acacgtgatgaagtagttattcctgagcaaaaattaattgctgaattgcctgttattaaa
tcaactttaaaaatgtttaaagtagaaactaagcagccaaccattgttacgacttcttta
tatgctgagccaacaccaattgatttaaatacgtttgattatgctacacagcgtattcaa
gttcttgatagcaatcaacaacctaaagttattgctccacttgaaacaactcaaacacgt
gtaaatattcagttaaatgagcaaaagttaacagcaccgttaatgaaagcgatgaatttg
gcaacagtttcaatttatcaaaacaaccagctcattcgcagtcttcaaattgaaaatgat
gtacacattgaagaagcaaatattttccaaagaattatgatgtggttctcaagcctattc
tcaatcttttcatcaagtgagcacagtgcagcaaaactctaccctatagattcgcactaa

DBGET integrated database retrieval system