KEGG   Acinetobacter baumannii BJAB0868: BJAB0868_03077Help
Entry
BJAB0868_03077    CDS       T02728                                 

Definition
(GenBank) Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit (PET112-like protein)
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
abaj  Acinetobacter baumannii BJAB0868
Pathway
abaj00970  Aminoacyl-tRNA biosynthesis
abaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abaj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BJAB0868_03077
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:abaj03029]
    BJAB0868_03077
Enzymes [BR:abaj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BJAB0868_03077
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BJAB0868_03077
Mitochondrial biogenesis [BR:abaj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BJAB0868_03077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AGQ11626
LinkDB All DBs
Position
3248224..3249693
Genome map
AA seq 489 aa AA seqDB search
MAEAQKLKLIDGWEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNTQASLVDLAMPGVLPV
LNEKVVELAIRFGLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQLE
DGTTKRIGVTRAHLEEDAGKSVHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVEEAVAYI
KAIHTLVRWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQAINVEI
ERQMEILEWGGEIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIPDEQIEAI
KATMPELPAARRARFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGAKQGKIAANWVM
GEFSGALNKAGLELTDSPVSAEQLGGMIARIIDNTISGKIAKQVFGFMWESEGKSADDII
AEKGLKQETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGKANPAQV
NELMKKLIG
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagctcaaaagttgaaattgattgacggttgggaagtcgttattggtattgag
attcatactcagcttgcaaccaattctaaaattttctcaggttcatcaactgaatttggt
caagacccaaatacacaagcgagccttgtagacttggcgatgccgggtgtattgccggtt
ttaaatgaaaaagtggttgaactcgcaattcgttttggtttagggattgatgcttacatc
gaccaagcttcagtatttgcacgtaaaaactacttctatcctgactctccaaaaggctat
caaattagccaaatggacaatccgattgtgggcttgggccatatcgacattcagcttgaa
gatggtacgactaaacgcattggcgtaactcgtgctcaccttgaagaagatgcgggtaag
tctgtgcacgaccaatttgaaggtatgtctggcattgacttaaaccgtgctggtacgcct
ttgcttgaaatcgtttctgaaccagacatgcgttcggttgaagaagcagttgcctacatc
aaagcaattcacacactagtacgttggttaggtatttctgacggcaacatggctgaaggt
tcattccgtgcggattgtaacgtgtctttacgtcgtccaggacaaccgtttggcacacgc
tgtgagcttaaaaacctcaactcattccgtttcattgagcaagcgatcaatgttgaaatt
gaacgccaaatggaaattttggaatggggcggcgaaattgatcaagaaacccgtttgttc
gatccaaataaaatggaaacgcgttctatgcgttctaaagaagaagcaaatgactaccgc
tacttccctgatccagacttgctaccagtaattattccagatgagcaaattgaggccatc
aaagcaactatgcctgagttgccagcagcacgccgtgcacgctttattgcagactttggc
gtaactgaatacgacgcacacgtacttacgctctcacgcgaaatggcggacttctatgaa
gctgttgttgctgcggctggcggtgcgaagcaaggtaaaattgctgcaaactgggtaatg
ggtgaattctctggtgctttaaacaaagcgggcttagagttaacagactcacctgtttct
gctgaacagcttggcggcatgattgcgcgtattatcgacaacaccattagcggtaaaatt
gctaaacaagtctttggctttatgtgggaatctgaaggtaaatctgccgatgacattatt
gcggaaaaaggcttaaagcaagaaaccgatactggtgcaattgaagcaatcattaaagaa
gtacttgcagccaatgaaaaaatggttgaagagtacaagtctggtaaagaaaaagccttt
aacggtcttgttggtcaagtcatgaaagcatctaagggtaaagctaatcctgcgcaagtc
aatgaattaatgaaaaaattgattggttga

DBGET integrated database retrieval system