KEGG   Acinetobacter baumannii BJAB0868: BJAB0868_03710Help
Entry
BJAB0868_03710    CDS       T02728                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
abaj  Acinetobacter baumannii BJAB0868
Pathway
abaj00480  Glutathione metabolism
abaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abaj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BJAB0868_03710
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:abaj02000]
    BJAB0868_03710
Enzymes [BR:abaj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BJAB0868_03710
Transporters [BR:abaj02000]
 Other Transporters
  Pores ion channels [TC:1]
   BJAB0868_03710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_C GST_N_2 GST_C_3 GST_C_2 GST_C_6 GST_N_4 GST_N_5 Tom37
Motif
Other DBs
NCBI-ProteinID: AGQ12257
LinkDB All DBs
Position
complement(3906074..3906673)
Genome map
AA seq 199 aa AA seqDB search
MIIYGDVDSGNCYKIKLLLSLLNIHHRWIHVDILNKDTQTAEFLSLNPNGKIPVLVLDDG
RVLSESNAILGYLAEGTELIPADPYMKAKMYQWMFFEQYSHEPFIAVARFINKYLGLPPE
RIEEYHKLQPKGHKALSIMNKALVGHDYLVGNKFTIADIALYAYTHVAEEGGFDLKLYPN
IQEWCQRIQKYPKYVSMVE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgataatctatggtgatgtagattcaggtaattgttataaaatcaaactgttactatcc
ctattaaatatacatcatagatggattcatgttgatattttaaataaagatactcaaaca
gcagagtttctatctttaaatcctaatgggaaaatacctgtattagttttagatgatgga
cgggttctaagtgagtctaacgctattttaggctacttggctgagggaacggaattgatt
cctgcagatccttatatgaaggcaaaaatgtatcaatggatgttctttgaacaatatagc
catgaaccatttattgcagttgctcgttttattaataaatatctaggattaccgccagaa
agaatagaggaatatcataaattacaacccaaaggccataaagcattatctattatgaat
aaagctttagtagggcacgactatcttgttggaaataaatttacaattgctgatattgct
ttatatgcatacacgcatgtagctgaggaaggcggcttcgatttaaagttatacccaaat
attcaagaatggtgtcaacgaattcaaaaatatccaaaatatgtgagtatggttgaataa

DBGET integrated database retrieval system