KEGG   Acinetobacter baumannii LAC-4: ABLAC_21810Help
Entry
ABLAC_21810       CDS       T03519                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
abal  Acinetobacter baumannii LAC-4
Pathway
abal00473  D-Alanine metabolism
abal01100  Metabolic pathways
abal01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:abal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ABLAC_21810
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    ABLAC_21810
Enzymes [BR:abal01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ABLAC_21810
Peptidoglycan biosynthesis and degradation proteins [BR:abal01011]
 Precursor biosynthesis
  Racemase
   ABLAC_21810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C DevR DUF4454
Motif
Other DBs
NCBI-ProteinID: AIY37536
LinkDB All DBs
Position
complement(2284676..2285968)
Genome map
AA seq 430 aa AA seqDB search
MKLKTNFSHLAYSCALVLFGSIQFAHAAPLLTSHITNEVSPAPTANAWIEVDTQAFEDNI
KRTNQLLNGKTQLCVVMKANAYGHSIDLLMPSVMKLNVSCIGITSNAEAAMVRKHGYKGK
ITRLRTATDSEIINAHALNIEELLGNYDQAARISKWAETNNTTVHYSLALNSGGMDRNGL
EMSTAQGKEQAVAITKLPNLKIDGIMTHYAVEDEKYVRERLAQFNEQTAWLIKKAKLNRK
ELTLHTANSFATVNVPESHLDMVRAGAIIYGDFPNHPEYKRMMAFKTQIAAVNNYLKGST
VGYDQTYTLTRDSKLANLPVGYSDGYRRSFSNKAFVLVNGQKAPVVGRVSMNTVMVDVTD
IPEAKAGDEVVLFGRQGNAEVQSSDLTSLTGHILTEAYTPWSNSNPQVIKPIQSPQQVIL
TNNKVTAKAN
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttaaaacaaatttttcgcatctcgcttatagctgtgcattggtattattcggt
tccatacaatttgcccatgctgcacctttactcacgtctcatatcacaaatgaagtcagc
cctgcacctacagcaaatgcatggattgaagttgacactcaagcttttgaagataatatt
aaaaggacaaatcaattacttaatggcaaaacacaactttgtgtagtcatgaaagcaaat
gcatacggccatagtattgatctacttatgccgagtgttatgaagttaaacgtatcgtgt
attggcatcaccagtaatgcagaagcagcgatggtgcgtaagcatggctataaaggcaaa
attacacgtttacgtacagcaactgatagtgaaatcatcaatgcacatgcgttaaatatt
gaagagcttttgggcaactatgatcaggctgctcgtatctctaaatgggcagaaacgaac
aatacaactgttcattatagcttggctttaaattcgggtggtatggatcgtaatggtctt
gaaatgtctacagctcaaggtaaagaacaagctgttgcaatcactaagcttccaaatctt
aaaattgacggcattatgacccattatgctgtagaagatgaaaaatatgttcgtgagcgc
ctagctcaatttaatgaacaaacagcatggttgattaaaaaagccaaactgaatcgtaaa
gaattaacattacatacagcaaattcatttgctaccgtaaatgttcctgaatcacattta
gatatggtccgtgcaggcgcaattatttatggagattttcctaatcacccagaatataaa
cgcatgatggcatttaaaacacaaattgctgcagttaataattaccttaaaggttcaact
gtaggttatgaccaaacttatacgttgacacgtgactccaaacttgcaaacctgcctgtc
ggttattcggatggctaccgtcgtagttttagtaataaagcttttgtcttagtcaatgga
caaaaagcgccagtggttggtcgagtatcaatgaatactgttatggttgatgtaacagat
attccagaagccaaagcgggcgatgaagttgtattatttggacgtcaaggcaatgctgag
gttcaatctagtgatttaacgagtcttacaggccatattttgacagaggcctatactcca
tggagtaactctaatccacaagtgattaaacctattcaatctccacaacaagtgatatta
accaataataaagttacagcaaaagccaactaa

DBGET integrated database retrieval system