KEGG   Acinetobacter baumannii LAC-4: ABLAC_25570Help
Entry
ABLAC_25570       CDS       T03519                                 

Definition
(GenBank) Homoserine dehydrogenase
  KO
K00003  homoserine dehydrogenase [EC:1.1.1.3]
Organism
abal  Acinetobacter baumannii LAC-4
Pathway
abal00260  Glycine, serine and threonine metabolism
abal00270  Cysteine and methionine metabolism
abal00300  Lysine biosynthesis
abal01100  Metabolic pathways
abal01110  Biosynthesis of secondary metabolites
abal01120  Microbial metabolism in diverse environments
abal01130  Biosynthesis of antibiotics
abal01230  Biosynthesis of amino acids
Module
abal_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:abal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABLAC_25570
   00270 Cysteine and methionine metabolism
    ABLAC_25570
   00300 Lysine biosynthesis
    ABLAC_25570
Enzymes [BR:abal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     ABLAC_25570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Homoserine_dh NAD_binding_3 Gp_dh_N TrkA_N DapB_N ELFV_dehydrog 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AIY37912
LinkDB All DBs
Position
2663444..2664448
Genome map
AA seq 334 aa AA seqDB search
MKRINVAICGFGRIGQQIAELLLNRSTYYKQKYQIDARLVGVCNSSSGLIDQEGLQASKW
LDKTQYQAGLTEQKFLKQVQADVIIETGPSDYVTGGKGLFYLNYALTHSMNAIAVSKGAL
VVEGKKLINLAHQHNKKLFFSGATAAALPTVDLFEYNLAGCQILEIESVFTGTTNFILND
MLQHECAFTESLEKAQARGIAEPNSSFDVDGWDTAAKITILANTVLGVDVKIQDIPRQGI
SHVTTEHIRDWKKENIIPRLVGFIHIKNQQIQTGVELRLVPANHPFAHLQGSNKCIRVLT
QEMGEFVVSGGASAPLATAAAALKDFELMLKTGC
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgaattaacgtggcaatttgtggttttggacggattgggcaacaaattgcagag
cttcttttaaatcgatcgacatactataaacaaaaatatcaaattgatgcccgtttagtg
ggtgtctgtaactcatcatcaggcttaattgaccaagaaggtttacaagcttcaaagtgg
ctagataaaacacaatatcaagcaggcctaacagagcaaaagtttttaaaacaggttcaa
gcagatgtcattattgaaactggaccaagtgattatgttaccggtgggaaaggcctattt
tatttaaattatgctttaacacatagtatgaatgcgatagcagtatctaaaggtgcttta
gtcgtagaaggtaaaaaactaattaacttggcacatcagcacaataaaaaactatttttt
agcggtgccactgctgcagctttaccgactgttgatttgtttgaatataacttggctggc
tgtcaaattttagaaatagaaagtgtgtttacaggcaccacgaattttattttgaatgat
atgttgcaacatgaatgcgcatttacagaatctcttgaaaaagctcaagcaagaggtatt
gctgaaccgaatagttctttcgatgtagatggatgggatactgctgcaaaaattacgata
ctagccaatactgttttaggagttgatgtaaaaattcaagatattccacggcaaggaatc
agccatgttacgactgaacatattcgtgattggaaaaaagaaaatataattcctcgtctg
gttggttttatccatattaaaaatcagcaaattcaaacaggtgttgaattaaggttagtc
ccagcaaatcatccgtttgctcatctgcaaggttctaataaatgtattcgggtgttaacg
caagaaatgggggaatttgttgtcagtggaggggcatctgcgccattagccacagcagcc
gcggctttaaaagattttgagttgatgctaaaaacgggctgctaa

DBGET integrated database retrieval system