KEGG   Candidatus Nanopelagicus limnes: B1s21122_00065Help
Entry
B1s21122_00065    CDS       T05073                                 

Definition
(GenBank) eukaryotic-like serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
abam  Candidatus Nanopelagicus limnes
Brite
KEGG Orthology (KO) [BR:abam00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:abam01001]
    B1s21122_00065
Enzymes [BR:abam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     B1s21122_00065
Protein kinases [BR:abam01001]
 Serine/threonine kinases: Other
  Bacterial family
   B1s21122_00065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Pkinase_fungal Kdo Seadorna_VP7 Haspin_kinase FTA2 UBA_4 Kinase-like
Motif
Other DBs
NCBI-ProteinID: ASY08771
UniProt: A0A286S9J4
LinkDB All DBs
Position
complement(11392..12936)
Genome map
AA seq 514 aa AA seqDB search
MNSPINKLAGGRYSVGQMIGTGGMADVYQGLDTRLNREVAIKVLRRDLAKDPAFVARFKK
EALAAGGLNHPGIVAVYDSGEENDSPFIVMELVSGVTLRQLMQSTQISQHKSLEIIKGIL
QALDYSHNKGIVHRDVKPGNIMITDSGDIKVMDFGIARATDDIGATMTSTWNVVGTAQYL
SPEQATGEVADGRSDLYSLGCVMYELLTGRPPFTGDTPVSVAYQHVSAQVTPASQIKPGL
DVNIDRLLEVVLAKDPAHRYQDAMAMLADLEHVIKGEPVTTKIKKVIPRRRVITGSIVVI
SLLALLTFGYFATSPNGATVKVPNVVGLTEDEARALLKNFNVNIEKAPDAKIPINRVASQ
LPLATSDVSAGSSVTLTISEGPGNTTVPVGLIGLSLEDARYKLTSAGLLISQTIAVDSDQ
APGVVISINPIPGTTITAGSGVVLEIASGNVQVPSLVGLNEIGAKTVLTQAGFLIREITA
FDPSKPVGEILAQAPEGGATKTIGSIVTITINKN
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcccaattaataagttagcaggtggtcgatacagcgtcggtcagatgatcggc
accggcggtatggcagatgtttaccaaggtttagataccagattaaatcgtgaggtagca
attaaagttttacgtagagatttagctaaggatcctgcatttgtggctagatttaaaaaa
gaagccctcgccgccggcggattaaatcatccaggaattgttgccgtttatgactcgggt
gaagaaaatgattcaccatttattgtgatggagttagtaagtggtgtaactcttcgccaa
ttaatgcaaagtacacaaatttctcaacataaatcacttgaaataatcaagggcattctg
caagcacttgattactctcacaataaaggaattgttcatagagatgtaaagcctggaaat
atcatgattacagactctggtgatattaaggttatggattttggtattgctcgtgccacc
gatgacattggcgccactatgacaagcacttggaatgttgttggcacagctcaatatctt
tctcctgagcaagcaactggtgaagtagcggacggcaggagtgatctttattcattaggt
tgtgtgatgtatgaattactaactggcaggccaccatttaccggagatacaccagtatca
gttgcataccaacatgtttcagcgcaggtaacaccagcatcacaaattaaacctgggtta
gatgtaaacatagatcgattacttgaagtagttctagccaaggatccagcccatcgttac
caagatgcgatggcgatgcttgctgatttagaacatgtaattaaaggtgagccagtaaca
acaaagattaagaaggttattccgcggcgcagagtaattactggatcaattgttgttatt
tctttactggccctgcttacctttggctactttgccacctcaccaaatggcgcgacagtt
aaggtgccaaatgttgttggtttaactgaggatgaagcaagggcgttacttaaaaacttt
aatgtaaacatcgaaaaggcgcctgatgcaaaaattccaattaatcgagttgcatctcaa
ttaccgcttgcaacctcagatgtgagcgctggaagtagcgtgacattaactatttcagaa
ggtccaggcaataccactgttccagttggtttaattggtttatcccttgaggatgcaaga
tataaattaacttcagcaggtctgcttatttcacaaactattgcagttgattcagatcaa
gcacccggagttgtaatcagcattaatccaatccctggaaccaccattaccgcaggaagt
ggcgtagtacttgaaattgcaagtggcaatgtgcaggttccttctttagtgggattaaat
gaaattggcgccaaaacagtgttaactcaagcaggatttttaattagagagatcacagct
tttgatccaagtaagccagttggtgaaattcttgcgcaagctccagaaggtggtgctaca
aaaactattggcagtattgtgacaattacaattaataaaaactaa

DBGET integrated database retrieval system