KEGG   Candidatus Nanopelagicus limnes: B1s21122_01110Help
Entry
B1s21122_01110    CDS       T05073                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
abam  Candidatus Nanopelagicus limnes
Pathway
abam00020  Citrate cycle (TCA cycle)
abam00480  Glutathione metabolism
abam01100  Metabolic pathways
abam01110  Biosynthesis of secondary metabolites
abam01120  Microbial metabolism in diverse environments
abam01130  Biosynthesis of antibiotics
abam01200  Carbon metabolism
abam01210  2-Oxocarboxylic acid metabolism
abam01230  Biosynthesis of amino acids
Module
abam_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:abam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B1s21122_01110
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B1s21122_01110
Enzymes [BR:abam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     B1s21122_01110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ASY08965
UniProt: A0A249JWR9
LinkDB All DBs
Position
complement(1051767..1052981)
Genome map
AA seq 404 aa AA seqDB search
MNKIKVEGTVVELDGDEMTRIIWQFIKDSLILPYLDINLEYYDLGIEYRDKTDDQVTIDS
AHAIQKHGVGVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGVIFREPIIIKNVPRL
IPHWTKPIVIGRHAFGDQYRATDFKVPGAGKLTVTFTPTDGSKPMEFNVFDFPSSGVAMA
MYNLDDSIRDFARASFNYGLIRKYPVFLSTKNTILKAYDGRFKDIFAEVFEKEFKAEFAK
NNLEYDHRLIDDMVATSLRWEGGYIWACKNYDGDVQSDTVAQGYGSLGLMTSVLMTPDGK
TVEAEAAHGTVTRHFRDHQVGKATSTNPIASIFAWTQGLAHRAKLDNTPKVAEFAKTLER
VCIQTVESGKMTKDLALLISKDAPWLNTQEFLAAIDDNLKKAMA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaataagataaaagtagagggcacagtagttgaattagatggcgatgaaatgaccaga
attatctggcagttcatcaaagactctttgatcttgccttatctggatataaatcttgag
tattacgacctaggcattgaatatcgggataagacagatgatcaggtaactattgattca
gctcacgccattcaaaaacatggcgttggcgttaagtgcgcaactatcacaccggatgag
gcgcgagttgaagagtttaagttgaagaaaatgtggaaatccccaaatggaacaatccgc
aatattttaggtggcgtaattttccgcgaaccaatcatcattaagaatgttccgcgctta
attccgcactggacaaagccaattgtgattggccgtcatgcgtttggtgatcaataccgt
gccacagattttaaagttccaggtgcaggaaagctaactgttactttcacaccaactgat
ggttcaaagccgatggagtttaatgtttttgattttccttcatctggtgtagcaatggct
atgtataacttggatgattcaattagagattttgcaagagcatcatttaactacggccta
atccgtaagtacccagtattcctttcgactaaaaatacaattcttaaggcatacgatggc
cgatttaaagatatctttgctgaagtttttgaaaaagagtttaaggcagagtttgccaag
aataatcttgagtacgaccatcgtttaattgatgacatggttgccacctcacttcgctgg
gagggtggatatatctgggcgtgtaagaattatgacggtgatgttcagtccgacactgtt
gcacaaggttatggatcactcggattaatgacttcagttctaatgactccagatggcaaa
acagttgaagcagaagcagcccatggaacagttacccgccacttccgcgatcatcaagtg
ggtaaagcaacctctacaaatccaattgcatctatctttgcttggacgcaaggcttagct
caccgcgccaaactagataacactcctaaggtcgcagagtttgctaaaactttagagcga
gtgtgtatccaaacagttgaaagcggcaagatgacaaaggatttagcactactaattagc
aaagatgcgccatggcttaatacccaagagtttttggctgctattgatgataatttgaag
aaagcaatggcttaa

DBGET integrated database retrieval system