KEGG   Candidatus Nanopelagicus limnes: B1s21122_02010Help
Entry
B1s21122_02010    CDS       T05073                                 

Definition
(GenBank) cold shock protein (beta-ribbon, CspA family)
  KO
K03704  cold shock protein
Organism
abam  Candidatus Nanopelagicus limnes
Brite
KEGG Orthology (KO) [BR:abam00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    B1s21122_02010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CSD OB_RNB
Motif
Other DBs
NCBI-ProteinID: ASY09127
UniProt: A0A249JX72
LinkDB All DBs
Position
889310..889513
Genome map
AA seq 67 aa AA seqDB search
MATGTVKWFNSEKGFGFIAVDGGGQDVFVHYSAIQGNGYKSLEEGQAVTFEVVQGPKGPQ
ADAVNPA
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaggtacagttaagtggttcaactctgaaaagggtttcggtttcattgcagtt
gatggtggcggacaagatgttttcgttcactactcagcaatccaaggaaacggttacaag
tcccttgaagagggtcaggcagttacattcgaagtagtccaaggtcctaagggtcctcag
gctgacgctgtaaaccctgcataa

DBGET integrated database retrieval system