KEGG   Candidatus Nanopelagicus limnes: B1s21122_05275Help
Entry
B1s21122_05275    CDS       T05073                                 

Gene name
sodN
Definition
(GenBank) nickel superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
abam  Candidatus Nanopelagicus limnes
Brite
KEGG Orthology (KO) [BR:abam00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B1s21122_05275 (sodN)
Enzymes [BR:abam01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     B1s21122_05275 (sodN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni DUF2937
Motif
Other DBs
NCBI-ProteinID: ASY09731
UniProt: A0A249JYY0
LinkDB All DBs
Position
complement(229267..229674)
Genome map
AA seq 135 aa AA seqDB search
MLKSLIEVIKPKQTVFAHCDLPCGVYDPAQAKIEAQSVKACMEKYAASSDPDFKSRAVAI
KEERSELVKHHLWVLWTDYFKPNHFEAYPQLHTLFNEATKLAGAGGSKGSNDVAVAEKLI
GKIDEIADIFWATKK
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaatctttaattgaagtaatcaagccaaagcaaactgtctttgctcactgtgat
ctgccttgcggtgtttatgatccagcacaagccaaaattgaagcgcagtctgtgaaagca
tgtatggaaaaatatgctgcaagcagtgatccagactttaaatcacgtgcggttgcaatc
aaagaggaacgttctgaactagttaagcatcacctatgggtgctgtggacagattatttc
aagccaaatcactttgaggcttacccacaacttcacacactatttaatgaagctactaaa
ttagctggtgctggtggcagcaaaggtagcaatgatgttgcagttgctgagaagttaatt
ggcaaaattgacgaaattgcagatattttttgggcaactaaaaaataa

DBGET integrated database retrieval system