KEGG   Anaerolineaceae bacterium oral taxon 439: BEQ56_00515Help
Entry
BEQ56_00515       CDS       T04463                                 

Definition
(GenBank) AP endonuclease
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
abao  Anaerolineaceae bacterium oral taxon 439
Pathway
abao00040  Pentose and glucuronate interconversions
abao00051  Fructose and mannose metabolism
abao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BEQ56_00515
   00051 Fructose and mannose metabolism
    BEQ56_00515
Enzymes [BR:abao01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     BEQ56_00515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AOH42098
UniProt: A0A1B3WM95
LinkDB All DBs
Position
111206..112132
Genome map
AA seq 308 aa AA seqDB search
MNFAGRMNSVLFQNREKDIFYAIDSLKKIEGITHLEFNFPEHIAPYSILKVKEAVAPLKV
NGVATRFRDDFIHGEFTNPNPKLNEKAMDLCKRAIDACRELNGEVVTIWLGFDGFDYPFQ
VNYEKKWNDIVRHFQDIADYANDLKISIEYKPFEPRSYSMIDGIGLTLLAIEEINRPNLG
VTLDFCHLLMKKESPGYALTLAARKNKLFGLHLNDGYRDMDSGMIFGSVNIPQSIEFIYY
LKKYAYDGVVFFDTFPIRENALSEIALNIESFRFFEERIKKVGLEEIENVINKQDGLSAQ
KLMLSLIK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgcagggcgaatgaattcagttcttttccaaaatagagaaaaggatatattt
tacgcgattgattccttaaaaaaaatcgaagggattacacacctggagtttaatttcccg
gagcatatcgctccttattcgatacttaaagtcaaagaagctgttgcaccgttgaaagtc
aacggcgtcgcaacccgcttcagagatgatttcatccatggcgagtttaccaatccaaat
ccaaagctcaacgaaaaagctatggatttatgcaaacgtgcaatcgacgcctgccgtgag
ttaaacggagaagtcgtgacaatctggttaggattcgacgggttcgattatccgttccaa
gtcaattatgaaaaaaaatggaacgacatcgtccgacattttcaagatatcgcagattat
gccaacgatcttaagatcagtatcgaatataaaccgtttgaaccaagaagttactcgatg
atcgatggaatcggcttgacgcttctggcaatcgaagaaattaaccgtccaaaccttggc
gtcacactcgatttctgtcacctactgatgaagaaagaatcgccaggatacgcgctgacg
ctcgccgcgagaaagaacaaactattcggactgcatttgaatgacggttaccgggacatg
gacagcggaatgatattcggatccgtaaatattccgcaatctatcgagtttatttattat
ctcaagaaatacgcttatgacggcgtcgttttttttgatacctttccgattcgtgaaaac
gcgctgtcggaaattgcgctgaatattgaatcattcaggtttttcgaggaaagaatcaag
aaagtcggattagaggaaatagaaaacgtcatcaataagcaggatggattatccgcgcaa
aaattaatgctgagcctgattaaatag

DBGET integrated database retrieval system