KEGG   Anaerolineaceae bacterium oral taxon 439: BEQ56_03470Help
Entry
BEQ56_03470       CDS       T04463                                 

Definition
(GenBank) 3-deoxy-7-phosphoheptulonate synthase
  KO
K03856  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
abao  Anaerolineaceae bacterium oral taxon 439
Pathway
abao00400  Phenylalanine, tyrosine and tryptophan biosynthesis
abao01100  Metabolic pathways
abao01110  Biosynthesis of secondary metabolites
abao01130  Biosynthesis of antibiotics
abao01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abao00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BEQ56_03470
Enzymes [BR:abao01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     BEQ56_03470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 DAHP_snth_FXD NeuB
Motif
Other DBs
NCBI-ProteinID: AOH42617
UniProt: A0A1B3WNX4
LinkDB All DBs
Position
745909..746934
Genome map
AA seq 341 aa AA seqDB search
MIVVLKKDPDERQLDNLIQWLKSLNLDVHLSSGINTTIVGLVGDTSVVDIDLIRALDIVS
DVKRVQEPYKNANRKFHPDDTVIEVSGIKIGGGNRVLMAGPCSVESEDQIVEIAKRVKAA
GAAFLRGGAFKPRSSPYAFQGLGKVGLELLKVARAETGLPIVTELMTSSQLPLFDDIDVI
QIGARNMQNFDLLKDVGHSDKPVLLKRGLANTLEELLMSAEYIMANGNHNVMLCERGFRT
FETAMRNTLDLAAIPYLKEKSHLPVIVDPSHATGAAALIKPVSLAATVVGADGLIIEVHN
NPAKAFSDGKQSLTPDAFDDVARSVRQLYPYAYDLWKEGRL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgattgtagtcttgaagaaggatccggacgaacgtcagctcgataatttaatccagtgg
cttaagagtttaaacctggatgttcatctgagttccgggatcaacacgacgatcgtcggg
ctggtcggggacacatcggtcgtcgatatcgacctgatccgtgcgctcgatatcgtttcc
gacgttaaacgcgttcaggagccgtataaaaacgctaatcgcaagtttcatccggacgat
acggttatcgaggtcagcgggattaagatcggcggcggaaaccgcgtcctgatggccggg
ccctgttccgttgaatccgaggatcagatcgtcgaaatcgcgaaacgcgtcaaggccgcg
ggcgcggcttttttacgcggcggcgcgttcaagccgcggtcctcgccatacgcttttcag
gggctgggaaaggttgggctggagctgctgaaagtcgcgcgggcggaaacggggctgccg
attgtgacggagctgatgacctcgtcgcagctgccgcttttcgacgatatcgacgtgatt
cagatcggcgcgcgcaacatgcagaattttgacctgctgaaggacgtcggacacagcgat
aaacccgtcctgctcaagcgcgggctggcgaatacgctggaggaattgctgatgagcgcc
gaatatatcatggcgaacggcaaccacaatgtgatgctctgtgagcgcgggttccggacg
tttgaaaccgccatgcggaatacgctcgatctcgccgccatcccctacctgaaagaaaag
tcgcatttgcccgtgatcgtcgatccgagccacgcgaccggagcggcggcgctgattaag
ccggtctcgctggcggcgacggtcgtcggcgcggatgggctgattatcgaagtgcataat
aatccggcgaaagcgttcagcgatgggaagcagtcgctgacgccggacgcgttcgacgac
gtcgcacgctcggtccggcagctctatccatacgcttacgatttatggaaagagggacgg
ttatga

DBGET integrated database retrieval system