KEGG   Anaerolineaceae bacterium oral taxon 439: BEQ56_04540Help
Entry
BEQ56_04540       CDS       T04463                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
abao  Anaerolineaceae bacterium oral taxon 439
Brite
KEGG Orthology (KO) [BR:abao00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:abao01001]
    BEQ56_04540
Enzymes [BR:abao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BEQ56_04540
Protein kinases [BR:abao01001]
 Serine/threonine kinases: Other
  Bacterial family
   BEQ56_04540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Sortase Pkinase_fungal APH Kdo RIO1 Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: AOH42808
UniProt: A0A1B3WPB2
LinkDB All DBs
Position
1009566..1011941
Genome map
AA seq 791 aa AA seqDB search
MSDDSMKTIGRYIIEREIGRGGMAVVYQAHDPHLDRSVAIKLIRKGAFTGDQLETLPERF
RREARALAKLDHPNIVKVLDYGEFEGSTYLVMEYLEGITLKEVKKPLRVEMAVRLIRPIA
EALEYVHDHGILHRDVKPSNIMITATKKVMLTDFGIAKWLEDRSDQFTLTGAGIGIGTPE
YMAPEQGLGKKIDARADMYALTVVFYELISGRKPFSGETPLEVLTKQVSDPIPDPRTIIP
ELNESVKKFLDRAMAKKPEDRYPTMMDYLRDLDGLRLQSIAEAASGNTGIQVTSRKDPTT
NSSVRFGKTDMRRVREAAEDRSSQAPKASGEDNTGRVTTKAEDHQNKNAAVRKPNRLRWL
LPAVGLLAILVGWIGIQRRAGRLPVEPMGTPTEMILGVERSQTDIPMIGMEPTAVVNHQG
KEAPVQSGTVFPSEFIPIAMTETEPAMGQGLTLIEPQQEIIETQSPERKMATHTAIAEQK
KAALYETVTAFNQRLTETKQGYYPARNPVSTPMLAGTSVLTMTPAFAATRLAQDMTSTAA
KLNLEGTAIAVHQKETELAAIVTEMTLTAVAAERIRLTEEEAAARAQAERIRLTELSLPT
ETPEPAATLSVDNPYADIKVGKILPRTGFAPGRITKLPEQPAAKLYQTSKLLMKIPALNQ
SLEIIGILRVDGEWDIAWLGQYAGYLEGSAYPTWEGNSIITAHVWAAYNNPGPFFGLKDL
RYGDKFMIEAYGKTYTYEIRESEQLLETDVEKMMTRKEGSWITLMTCTTYDASEDRYKYR
YLVRGVLIEVN
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgacagcatgaagacgatcgggcggtacatcatcgagcgggagatcgggcgc
gggggaatggcggtcgtgtaccaggcgcacgatccgcatctggatcgatcggtcgcgatt
aagctgatccggaagggagcgtttaccggggatcagctggaaacgctcccggaacgcttt
cggcgcgaagcgcgcgcgttggcgaagctggaccatccgaatatcgtgaaggttttagac
tacggggagtttgaagggtcgacgtatctggtcatggagtatctcgaaggaataacgctg
aaggaggtgaaaaagccgctgcgggtagaaatggcggtgcggctgattcgtccgatcgca
gaggcgcttgaatacgtccatgatcatgggatactccaccgtgacgtcaagccatcgaat
atcatgattacggcgacgaagaaggtcatgctgacggatttcgggatagcgaaatggctg
gaagatcgatcggatcagtttacgctgacgggggcggggatcggaatcgggacgccggaa
tacatggcgccggagcaggggttgggtaaaaagatcgacgcgcgggcggatatgtatgcg
ctgacggtggtattttatgagctgattagcgggagaaaaccgttttccggcgaaacgccg
cttgaagtgctgacgaaacaggtcagcgatccgattcctgatccaagaacgattattccc
gagctgaacgaatcggtaaagaaattcttagatcgagcgatggcgaagaagccggaggac
cggtatccgacgatgatggattatttacgggatctggacgggctgcggctgcagtcgatc
gcagaggcggcgagcggaaatacagggattcaggtcacttcgcgcaaggatccaacgaca
aacagctcggtccgctttgggaaaacagacatgcggagggttcgcgaggcggcggaagac
cgttcgagccaggcgccgaaagcttcaggggaagacaatacggggcgcgtgacgacaaaa
gcggaggatcatcagaataaaaacgccgccgtaagaaaaccgaatcgcctgcgctggctc
cttcctgcggtgggactgctggcgattctcgtgggatggatcggaattcagcgtcgggcc
ggaagattgccggttgaaccgatggggacgccgactgagatgatccttggcgttgagaga
agtcagacggacatccccatgattgggatggaaccgacggctgtcgttaatcatcagggg
aaagaggctcccgtgcagtcgggaaccgtctttccgtcggaatttataccgattgcgatg
accgaaacggaaccggcgatgggtcagggtttgacgctgatcgagccgcagcaggaaatc
attgaaactcagtctcctgaaaggaaaatggcaacgcatacggcgatcgcagagcagaaa
aaagcggcgctttacgaaacggtaaccgcgttcaatcagcggttaaccgaaacaaaacaa
ggttactatccggctcgtaatccggtttctacgcccatgcttgccggaacgtcggtactg
acaatgacgccagcctttgcagcaacgcgcctggcgcaggatatgacgtcaaccgccgcg
aagctgaatcttgagggaacggcgattgccgttcatcagaaagaaacggagttggcggcg
attgttacggaaatgacgctgacggcggtcgccgcggaacggatccgattgacggaagaa
gaggcggcggcacgggcgcaggcggagcggatccgattgacagagcttagcctgcctacg
gaaacgccggaaccagctgcgacgctttcggttgataacccgtatgcggatataaaggtt
gggaaaatattgccgcgcaccggtttcgctccggggcggatcacgaaactgccggaacag
ccggctgcgaagctctaccagacatcgaagctgctcatgaagattccggccctgaaccag
tcgctcgaaatcatcggcatcttgcgggttgacggcgaatgggatatcgcgtggctcgga
cagtacgccggctacctcgaggggtcggcgtatccgacctgggaaggtaactcgatcatc
accgcccacgtctgggccgcctacaacaacccgggtccgttcttcggattgaaagacctg
agatacggcgacaagttcatgatcgaagcctatggcaagacgtacacgtacgagattcgc
gaatccgaacagctgctcgaaacggacgttgaaaagatgatgacgcggaaggaaggcagc
tggatcactttgatgacttgcacgacgtatgatgcgagcgaagatagatataaatatcgc
tacctggtccgtggcgtactgattgaagtgaattga

DBGET integrated database retrieval system