KEGG   Anaerolineaceae bacterium oral taxon 439: BEQ56_04665Help
Entry
BEQ56_04665       CDS       T04463                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
abao  Anaerolineaceae bacterium oral taxon 439
Pathway
abao00500  Starch and sucrose metabolism
abao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BEQ56_04665
Enzymes [BR:abao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BEQ56_04665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: AOH42828
UniProt: A0A1B3WPD4
LinkDB All DBs
Position
complement(1039585..1041045)
Genome map
AA seq 486 aa AA seqDB search
MKNGVMLQAFEWNTEGGGTFYDRIRNQAAQFAGAGFTALWLPPAFKGTSSLDVGYGTYDL
YDLGEFDQKEETRTKYGTKAQYLDCVRELKRRGLEVYADVVLNHKAGADGVELFRVVEVN
RDDRTEVISDPFDIEGWTRFDFPGRGGRYSAFKWNFNHFSGVDYDRISNRGGIFKILGDN
KDWSRDVSSELGNFDYLMFADVNTDHPDVRDELKRWSDWFIAETGVDGFRMDAVKHISAD
FMRDFVEHVKEQQGDQFYFVGEYWKTDSSETNRYLYETNYDMDIFDVKLHFHFAEAAWHG
AEYDLRTVFDNTVVREHPALAVTFVDNHDSQPGQALESWVGEWFKPLAYALILLRKDGYP
CVFAGDYWGINGDPDRPGFQSEIDRLLRIRRQFLSGDQEDRFDHPNLIGWIQHGDDENPG
KLATLVCTSDDEMRMRIEFGPTYAGRVFADYSGRRDDKITLDENGAADFPVSARSYSVWG
DRSFTA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacggcgtcatgcttcaagcgtttgaatggaataccgaaggcggcggcacgttc
tacgaccgaatccgaaatcaggcagcccagttcgcgggcgccggattcaccgcgctttgg
cttccccccgcgtttaaggggacctcgtcgcttgacgtcggatacgggacgtacgatctt
tacgatcttggcgagttcgatcagaaggaagaaacgcggacgaaatacggaaccaaggcg
cagtacctcgactgcgtccgcgaattgaaacggcgcgggctcgaagtttacgccgacgtc
gtgctgaatcataaagccggtgcagacggcgtcgaacttttccgcgtcgtcgaggtcaat
cgcgacgaccgaaccgaagtcatttccgacccgttcgatatcgaaggctggacgcgcttt
gacttccccggccgcggcggccgctactccgcgtttaaatggaacttcaatcatttcagc
ggcgtcgactacgaccggatctccaatcgaggcggtatcttcaaaatcctcggcgacaac
aaagattggtcgcgggacgtatccagcgagctcgggaacttcgattacctgatgttcgcg
gacgtcaacacggatcacccggacgtccgcgacgagctgaaacgctggagcgactggttt
atcgcggaaaccggcgtcgacggcttccggatggacgcggttaagcatatcagcgccgac
ttcatgcgcgatttcgtcgaacacgttaaggaacagcagggggaccagttttactttgtc
ggcgagtactggaaaaccgacagctcggagaccaaccgttacctctacgaaacgaactac
gacatggatatcttcgacgtcaagctccatttccatttcgccgaagccgcctggcacggc
gcagaatacgacctgcgaaccgtttttgataataccgtcgtccgggaacacccggcttta
gctgtaacgttcgtcgataatcatgacagccagcccggacaggcgctcgaatcctgggtc
ggagaatggttcaagccgctcgcttacgcgctgatcctgctccggaaggacgggtacccc
tgcgttttcgccggcgactactgggggatcaacggcgatcccgaccgtccggggttccag
tccgaaattgaccgcctcctccggatccggcggcaattcctctccggcgaccaggaagac
cgttttgatcatcccaacctgatcggctggattcagcatggcgacgatgaaaatccgggg
aaactggcgaccctcgtctgcacgagcgatgacgaaatgcgcatgcgtatcgagttcggc
ccaacgtacgccggccgcgtcttcgccgactacagcggccgccgcgacgataaaattacg
cttgacgagaacggcgcagccgacttccccgtttcagcccgctcctactcggtctgggga
gatcgaagcttcacggcgtaa

DBGET integrated database retrieval system