KEGG   Anaerolineaceae bacterium oral taxon 439: BEQ56_06825Help
Entry
BEQ56_06825       CDS       T04463                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
abao  Anaerolineaceae bacterium oral taxon 439
Pathway
abao00040  Pentose and glucuronate interconversions
abao00051  Fructose and mannose metabolism
abao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BEQ56_06825
   00051 Fructose and mannose metabolism
    BEQ56_06825
Enzymes [BR:abao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     BEQ56_06825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Shikimate_DH ADH_zinc_N_2 ThiF TrkA_N NAD_binding_8 2-Hacid_dh_C URO-D
Motif
Other DBs
NCBI-ProteinID: AOH44446
UniProt: A0A1B3WU25
LinkDB All DBs
Position
complement(1518602..1519630)
Genome map
AA seq 342 aa AA seqDB search
MNALVLTEYKKLVYRQVPKPAIQANEVLIRVKACGICGSDIHGYDGSTGRRQPPVIMGHE
ASGVIEAIGASVEGWAVGDRVTFDSTIYCNRCSYCMHGAVNLCGSRRVLGVSCDDYRQDG
AFAEYIAVPAHILYKLPDNVTFAQASLVEPLSVALHAVNLCPRELNASATVIGAGKIGLL
IIQTLRAAGYGKILVVDRNAFHRELALQMGADQAFDFEPDAIQAIRSETNGEGTDIVLEV
VGVDEAFDLALKSARKGGTIVLVGNITPIVNFPMQWVVTRQLTLRGSCASAGEYPACLDM
IARGTIRLDKIISATAPLKDGDAWFQRLYAGDGDYVKVVLNP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctttagttctgaccgagtacaaaaaactcgtctatcggcaggtccccaaacca
gcgattcaggcaaacgaagtcctgatccgcgtgaaagcctgcggaatctgcggttccgac
attcatggttacgacggctcaaccggccggcgtcagccgcccgtgatcatgggacacgag
gcttccggcgtcattgaagccatcggcgcgagcgttgaaggctgggcggtcggcgaccgc
gtcaccttcgattcgacgatctactgcaatcgctgcagctactgcatgcacggggccgtt
aatctctgcggcagccgccgcgtccttggcgtttcctgcgacgactatcggcaggatggc
gcgttcgccgaatatatcgcggtcccggcgcatattctctataaacttcccgacaacgtc
acctttgcccaggcgtcgttggttgaaccgctttcggtcgcgctgcatgcggtcaacctc
tgtccgcgcgagctgaacgcgtcggcaacggttatcggcgcgggaaaaatcgggcttcta
atcatccagacgctccgcgccgcgggatacgggaagatcctcgtcgtcgaccgcaacgcg
tttcatcgggaactcgcgctgcagatgggcgcggaccaggcgttcgatttcgagccggac
gcgatccaggcgatccgatcagaaacgaacggcgaagggacggatatcgttctcgaagtc
gtcggcgtcgacgaagcctttgacctggcgctcaagtcagcgcggaaaggcgggacaatc
gtcctcgtcggaaatattacgccgatcgtaaacttccccatgcaatgggtcgttacccgc
caactgacgctgcgcggctcctgcgcgtccgccggcgagtatcccgcctgcctggacatg
atcgcgcgcggaacgatccgactggataagattatcagcgcgaccgctccgctgaaagac
ggcgacgcatggtttcagcggctgtacgccggcgacggggattatgtcaaggtcgtgctg
aacccgtaa

DBGET integrated database retrieval system