KEGG   Anaerolineaceae bacterium oral taxon 439: BEQ56_11390Help
Entry
BEQ56_11390       CDS       T04463                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
abao  Anaerolineaceae bacterium oral taxon 439
Pathway
abao00620  Pyruvate metabolism
abao01100  Metabolic pathways
abao01120  Microbial metabolism in diverse environments
abao01200  Carbon metabolism
Module
abao_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:abao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BEQ56_11390
Enzymes [BR:abao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     BEQ56_11390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M Pyr_redox_2 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AOH44022
UniProt: A0A1B3WSU7
LinkDB All DBs
Position
2572872..2574137
Genome map
AA seq 421 aa AA seqDB search
MAINKEAALEYHHRNGVPGKLSVTPTKPLDTFIDLSLAYSPGVAYPVLEIEKDPADAYRY
TNKGNLVAVISNGTAILGLGSRGALASKPVMEGKGVLFKKFAGVDVFDIEVDTTDPQRFI
DAVAAIGNTFGGINLEDIKAPECFLIEKTLQETLDIPVFHDDQHGTAIILAAGLLNAAEI
AGKKIGELKVVMNGAGAAGISCARHLIRIGADPKKIYLCDSAGLIYQGRTEKMTPEKREF
MNGAGPAALADILPGADVFIGLSIADILTEEMVKSMAENPFIFALANPNPEIKVETAKRV
RPDAIIATGRSDYANQINNVLGFPYIFRGALDVRAKRINEEMKLAASYALAELTKLPVPD
SVLKSYALDSLSFGRDYIVPKAFDPRAKWMVSSAVAQAAISSGVAQSPIDIDEYQARLGK
M
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaacaaggaagcagcactcgaatatcatcaccgcaacggcgttccggggaag
ctctccgtcacgccgaccaagccgcttgacacgtttatcgacctcagtctcgcttactcg
ccgggcgtcgcctatccggttctcgaaatcgaaaaggaccccgccgacgcgtaccggtat
accaataagggcaatctggtcgccgttatttccaacgggaccgcgatcttaggactgggc
agtcgcggcgcgcttgcctcgaaaccggtcatggagggaaaaggcgttctctttaagaag
ttcgccggcgtcgacgttttcgatatcgaggtagacacgaccgatccgcagcggttcatt
gacgccgtcgccgcgatcgggaacacgttcggcggcatcaatcttgaggatatcaaagcg
ccggaatgcttcctgatcgaaaaaacgcttcaggaaacgctcgatatcccggttttccat
gacgaccagcacggaacggcgattatcctcgccgccggtctcctgaacgcggccgaaatc
gccgggaagaaaatcggcgagctgaaagtcgtgatgaacggcgcgggcgcggccgggatc
tcctgcgcaaggcacctgatccggatcggcgccgaccccaagaaaatttacctttgcgac
tcggccgggctgatttatcagggacgaacggagaagatgacgccggagaagcgcgagttc
atgaacggcgcgggcccggcagcgttggccgacatcctccccggcgcggatgtctttatc
ggactgtcgatcgcggatatcctgaccgaagaaatggttaaaagcatggcggagaatccg
tttatattcgctctcgcgaatcccaacccggaaatcaaggtcgaaacggcgaagcgcgtc
cgccctgacgcgattatcgcgaccggacggtcggattacgcgaaccagatcaataacgtc
ctcggcttcccgtatattttccgcggagcgctcgacgtccgcgcgaaacggatcaatgaa
gaaatgaaactggcggcgtcatacgcgctggcggagctgacaaagcttccggttccggat
tccgtcctgaaatcctacgcgctggatagcttatcgttcggacgcgattatatcgtcccg
aaagcgttcgacccacgcgcgaaatggatggtctcgtcggcggtcgcccaggccgcgata
tcaagcggcgtcgcccaaagtccaatcgatatcgacgaatatcaggcgcggcttgggaaa
atgtaa

DBGET integrated database retrieval system