KEGG   Acidisarcina polymorpha: ACPOL_0116Help
Entry
ACPOL_0116        CDS       T05576                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
abas  Acidisarcina polymorpha
Pathway
abas00061  Fatty acid biosynthesis
abas00780  Biotin metabolism
abas01100  Metabolic pathways
abas01130  Biosynthesis of antibiotics
abas01212  Fatty acid metabolism
Module
abas_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:abas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ACPOL_0116
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ACPOL_0116
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ACPOL_0116
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:abas01004]
    ACPOL_0116
Enzymes [BR:abas01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     ACPOL_0116
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     ACPOL_0116
Lipid biosynthesis proteins [BR:abas01004]
 Fatty acid synthase
  Component type
   ACPOL_0116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AXC09503
UniProt: A0A2Z5FS10
LinkDB All DBs
Position
110544..111311
Genome map
AA seq 255 aa AA seqDB search
MLNLEGRTAVVFGLANKRSIAWAIAQKLHAAGVNLAISYQNERLRADAEDLVAELPGAQL
FQCDVSADADIDRVFAELKERYGKLHVLVHSIGFAPADEMKNDFVLTSREGFRIAHDVSV
YSLIALSRGAAPLMTEGGSIITLTYYGAEKVFPRYNVMGVAKAALEATVRYLAADLGRKN
IRVNAISAGPIKTLAARGIGNLSEMLKAHADRAPLGRNVEQAEVGGAALYLASDLSTAVT
GEVHYVDAGYNVMGF
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgctcaacctggaaggccgcactgcagtagtttttggtctcgcgaacaagcgtagtatt
gcctgggccatcgcccagaagcttcatgccgccggcgtcaatctcgccatcagctaccag
aacgaacgccttcgcgccgacgcagaggatcttgtcgccgaacttccgggggcccagtta
ttccagtgcgatgtctctgccgatgccgacattgaccgcgtcttcgccgagctgaaggag
cgctatggcaagttgcacgtgctcgtccacagcattggctttgcccccgccgatgagatg
aagaatgacttcgtgctgaccagccgcgaaggcttccgcattgcccacgatgtcagcgtc
tattcgctgatcgcgttgagccgcggcgccgccccgctcatgactgagggtggcagcatt
atcaccctcacctactacggagcggagaaagtcttcccgcgatacaacgtcatgggcgtc
gccaaagccgctctagaggcaactgtccgttatctggccgcagatctcggcagaaagaac
atccgggtgaacgcgatctccgccggcccgattaagacccttgccgctcggggaatcggc
aacctgagcgagatgttgaaggcccacgccgaccgggctccgctaggccgtaatgtagaa
caggccgaggttgggggcgccgccctctatctggcatccgacctcagcactgcggtcacc
ggagaagtccactatgtggatgccggatacaacgtcatgggattttga

DBGET integrated database retrieval system