KEGG   Acidobacteriaceae bacterium SBC82: ACPOL_1798Help
Entry
ACPOL_1798        CDS       T05576                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
abas  Acidobacteriaceae bacterium SBC82
Pathway
abas03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:abas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    ACPOL_1798
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:abas03400]
    ACPOL_1798
Enzymes [BR:abas01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ACPOL_1798
DNA repair and recombination proteins [BR:abas03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     ACPOL_1798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AXC11140
UniProt: A0A2Z5FWQ1
LinkDB All DBs
Position
1909437..1912214
Genome map
AA seq 925 aa AA seqDB search
MATRRKGAAKPSTQATPADAIDAQLERYRSMRDFDVTAEPSGGKKTEAAPQGLPFVIQKH
AATRLHYDFRLGWNGVLKSWACAKGPSYVTADKRLAVQVEDHPMEYGGFEGIIPKGQYGG
GTVMLWDEGTWEPQPGHTDVDEGLRTGSLKFIMHGTKMKGKWTLIRMGGKAASESKPNWL
LIKEHDDFERKPDDPAITEEAPNSVVTGRSLEEIARNEDHVWNSKETATGNAWHRNDQQS
KSEKPVTTAGAASKKSAVRAGAASNNAASNNFEAELKKTPKEKLPDFIRPQLASQATKPP
ADKGWIHELKLDGYRIQARKDGERVQLLTRTGLDWTHRMKTIAAEVAKLPADNFLADGEV
VVLADDGTTSFADLQAAFQEGIRKPLTYFVFDLLHLNGHNLRGLPLLERKAMLAKLLHES
GEFVRLGEHLETDGATMFRKACEFGAEGIVSKRADSPYSSSRSSSWLKLKCIRGQEFVIG
GFTLPSNGIHGVGALLLGYYQDKKLIYAGRTGTGFTQKTHAKLRDQLDKLRQSSTAFEKP
PAEARKGAIWVRPELVAQVNFSTWTADNLVRQASFQGLREDKPASEVVREAAGTSPKPRI
PKHADPAPSAEKAVPSLASRNNTGEGKTQHAPIRLTHPDKILDAASQLTKQQLADYYWQI
APFMLPHIAGRPLSLVRCPEGSGQPCFFQKHASNMLPKSLESVEVRDKKTGKIEPYITLS
TQTALAELAQLGVLELHPWGSRNEDLEHPDRIIIDLDPDTAIEWQTLAASAAEVRAALKK
LHLESFLKTTGGKGLHVVIPIEPEYDWGVVKQFAHAFALSMEKQNPALYLTKMTKSARAG
RIYIDYLRNERGATAVAPFSPRARPEANVSMPINWSELKLPERPTFRVVDFAEWSSRLKR
DPWKRLPATNQRITPEVLSSFKISA
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccaggcgcaaaggcgcagccaagccgtcaacccaagccactcccgcagacgca
atcgacgcgcaactggaacgctatcgctccatgcgggatttcgacgtcaccgcggagcca
agtggcggcaagaaaactgaggccgctccccaaggattgcccttcgtcatccagaaacac
gccgccactcgtctccactacgacttccggctgggctggaatggagtgctcaaaagctgg
gcttgcgccaaaggccctagctacgtcaccgccgacaaacggctggccgtccaggtcgaa
gaccaccccatggagtacggcggctttgaaggcatcatccccaaaggccaatatggcggc
ggcaccgtcatgttgtgggatgaagggacctgggagccgcagcccggccacaccgatgtg
gacgaaggcttacgcaccggctcactcaaattcatcatgcatggcacgaagatgaaggga
aagtggacgctgatccgcatgggtggcaaagccgccagtgagagcaagcccaattggctg
ctgatcaaggaacacgacgactttgagcgaaagccggacgatcccgcgatcacggaagag
gccccgaacagcgttgttaccgggcgcagcctcgaggagattgcccgcaacgaggaccat
gtctggaactcgaaggaaacagctaccggcaacgcctggcaccgtaacgaccaacagtca
aagtccgaaaagccagtaactactgccggcgccgcttcaaagaagtccgctgttcgagcc
ggggcagcatcgaacaacgccgcgtcgaataacttcgaagccgagctaaagaaaactccc
aaggaaaagctgccagacttcattcgtccccaattggcttcgcaggccacgaagccgccg
gctgacaagggctggattcatgagctgaaactcgatggctaccgaattcaagctcgcaaa
gacggcgaacgagttcaacttcttacccgcaccgggctcgattggacccatcgcatgaag
accatcgccgctgaggtggccaaactccccgctgacaacttccttgccgacggcgaggtc
gtggtgctcgccgacgatggaaccactagctttgccgacctgcaggctgcttttcaagag
ggaatccgcaagccgctgacctacttcgtcttcgacctgcttcatctcaacggccacaac
ttgcgcggcctgcccctgctcgaacgcaaggccatgctggcgaagctcctccatgagagc
ggcgagtttgtgcgtcttggggaacaccttgaaaccgatggcgcgaccatgttccgcaag
gcctgcgagttcggcgccgagggcatcgtctccaagcgcgccgatagtccttacagcagt
tcgcgcagctcctcttggctcaagctgaagtgcatccgaggccaggagttcgtcatcggc
ggcttcactcttccctcgaacggcattcacggcgtaggcgcgctgctgctcggctactat
caggacaagaaactgatctacgctggccgtaccggaaccggatttacccagaagacccac
gccaaactgcgcgatcagttggacaaactacgccagtcctccaccgctttcgagaagccc
cccgccgaggcccgtaagggcgcgatctgggtcaggccggagctcgtcgctcaagtcaat
ttctctacttggaccgccgacaacctcgtccggcaagcatcttttcagggccttcgcgag
gacaagccggccagtgaagtcgttcgcgaagcagccggcacttctccaaagcctcgcatt
ccaaagcacgccgatcctgcgccttcagctgagaaagccgttcccagcctagcctctcgc
aacaacaccggcgaaggaaagactcagcatgccccgatccgcctgactcatcccgacaaa
attctggacgccgcctcgcagctcaccaagcaacaacttgctgactattattggcagatc
gcgcctttcatgcttccgcatattgcagggcgtccgctctcgctcgtgcgctgtccggaa
ggcagtgggcagccctgtttctttcagaaacacgccagcaacatgcttcccaaaagcctc
gaatccgtagaggttcgcgacaagaagactggcaagattgaaccctacatcacgctttcg
acccagacggcgctcgctgaactggcgcaactgggggtgctcgaactccacccctggggt
tcccgtaacgaggatctggagcatcccgaccgcatcatcatcgacctcgatccggatacc
gccatcgaatggcagacgcttgcggccagcgccgcggaagtccgcgccgccctcaagaag
ctacacctcgagagctttctcaagaccaccggcggcaagggattgcacgtcgtcattccg
atcgagcctgaatacgactggggggtcgtgaagcaatttgcgcacgccttcgccctcagc
atggagaagcaaaatccggccctatacctcaccaaaatgaccaagtccgcccgcgccggt
cgcatctacatcgactatctccgcaacgaacgcggcgctactgcggtggctcccttttca
ccccgggcccggcccgaggcaaacgtctccatgccgatcaattggtcggagctgaagctc
cctgaacgccccaccttccgcgtcgtggacttcgctgagtggagcagccgcctgaaacgc
gatccctggaagcggctgccagccactaaccaacgaatcacccccgaggtcctcagctcc
ttcaaaatctctgcttga

DBGET integrated database retrieval system