KEGG   Acidisarcina polymorpha: ACPOL_4029Help
Entry
ACPOL_4029        CDS       T05576                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
abas  Acidisarcina polymorpha
Pathway
abas00040  Pentose and glucuronate interconversions
abas00051  Fructose and mannose metabolism
abas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ACPOL_4029
   00051 Fructose and mannose metabolism
    ACPOL_4029
Enzymes [BR:abas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     ACPOL_4029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C UDPG_MGDP_dh_N Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AXC13308
UniProt: A0A2Z5G2I9
LinkDB All DBs
Position
complement(4314183..4315214)
Genome map
AA seq 343 aa AA seqDB search
MKALVLEEVRGLHLRDVPEPELKTHDVLIQVKACGICGSDVHGYDGSTGRRIPPIIMGHE
AAGVVSKVGLDVSSFKVGDRVTFDSTVSCGHCAYCLAGEVNLCDNRQVLGVSCGDYRRNG
AFAEYVAVPEHIVYSLPDSFEYEKAALIEAVSIAVHAAKITEIEQGSTCVVIGVGMIGLL
AVQAFKYFGCTRVFAVDLEQSKLDTAKKLGADETFLATDPDLFAQLNKAAGGRGIDIAVE
VVGAQKSITTAIEAVRRGGKVTLIGNLAPKVEIPLQIVVTRQITLLGSCASAGEYGECIE
LMESGAIDVGPLLSAVAPLSEGAEWFNRLYNREPGLMKVILQP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacttgttttagaagaagtacgcggcctgcatcttcgcgatgttcccgagcct
gaactgaagactcatgatgttctcatccaggtgaaagcttgcggcatctgtggaagcgat
gtccacgggtacgatgggagcaccggccggcgcattccgcccatcataatgggacacgaa
gcagccggggtcgtctcaaaggttggcctcgatgtcagctcctttaaagttggggaccgc
gtcacctttgactcgaccgtgagctgtggtcactgcgcctactgcctggctggagaggtg
aacctttgcgacaaccgccaggtgctcggcgtttcttgtggcgactatcgtcgcaatggc
gcctttgctgagtacgtcgccgtcccggagcacatcgtctactcactgcccgacagcttc
gagtatgagaaagccgctctcattgaggccgtttcgatcgccgttcatgcggcgaagatc
acggagatcgagcagggcagcacatgcgtcgtgattggcgttgggatgatcgggctcctt
gctgttcaggcgttcaagtatttcggctgcaccagggtcttcgccgtcgatctcgagcag
agcaagctggataccgcgaagaagcttggcgcggacgagacctttctcgcgactgatccg
gacctctttgctcagctcaataaggccgccggtggccgtggcatcgatatagcggtcgag
gttgtcggcgctcagaagtccatcacgactgccattgaagcagtccgacgcggcggcaag
gttacactgatcggcaacctcgcgcccaaggtcgagatacccctgcagatcgtcgtcacc
aggcagatcactctgctcggatcctgtgcctcggcgggcgagtatggtgaatgcatcgaa
ctcatggagagcggcgcgatcgacgttggcccacttctttccgcggtggccccgttaagc
gaaggcgccgagtggttcaaccgcctctacaaccgcgagcccgggctgatgaaagtaatc
ctccaaccttaa

DBGET integrated database retrieval system