KEGG   Acidisarcina polymorpha: ACPOL_4087Help
Entry
ACPOL_4087        CDS       T05576                                 

Definition
(GenBank) hypothetical protein
Organism
abas  Acidisarcina polymorpha
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AXC13364
UniProt: A0A2Z5G3H8
LinkDB All DBs
Position
4383740..4385113
Genome map
AA seq 457 aa AA seqDB search
MVRRQIHAFRPHHSRKKLHSSSPTPALHYAISRRTPQSQHGITTPAPFYSSRRSADPSGS
GMDQDMEQQWSKERHSLRVDVEGAADKAESPMDSALPAPAIVNANNMQEEHLRGSSSSRE
AKDNVNPAARSSEPATGGPGAVHGTDLTGIFKQVAVRDAVQQLPRKLPAKEKEQTANSGR
TLHATDVFSTLSGPPKSEEPGFTQMFQALGTNNSSPHDSLPRDRNNVSESDGFFADRPKG
HPVPEWPESSDPGASRPAPSYGAGGFTQLFRKLDHESESPEITQQERFAAEAGQTPQPGG
GFTQLLRTLSSESDAGLPTDHPSPMVQPPPEGPGEFTRIVSRSALRDAASRREHENVKAQ
DESFAPEMQAQPQRSAINPNRSASDPQYLSNSQPMLAPLPLEQSEQVATAPRSAGATASP
HQPLGKLQQYIPVLLIANFFTMFIVLVLLVFILLRHR
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcggcgccagatacatgccttcagaccacaccactcgcgaaagaaacttcatagt
agctcgcccacaccggctctgcattacgccatcagcaggcgcactccgcagtctcagcat
ggaataaccacacccgcgccgttttattcctccagacggtcagcagacccatcggggagc
ggcatggatcaagacatggagcaacagtggtcgaaagagcggcacagccttcgggtggat
gtagaaggagccgctgataaggcggaaagtccgatggactcggctctcccggcacctgct
atcgtgaatgctaacaatatgcaggaagagcaccttcgaggaagttcctcctcaagggaa
gccaaggacaacgtaaacccagccgcaagatcgagcgagccagcaactggaggtcccggg
gctgttcacggtaccgatctgactggaatattcaagcaagtggcagttcgtgacgccgtg
cagcagctaccgaggaagctgcctgccaaggagaaagagcaaactgcgaactccggtaga
accctccacgctaccgacgtattttcgacattgagcggtccgcccaaaagtgaggagccg
ggattcacccagatgtttcaggcgcttggaacgaataactcttcaccccatgactctcta
cctcgcgatcgaaataatgtcagtgagagcgacggttttttcgcagatcggccgaaaggt
catccagttccggagtggcctgagtcctcggatccaggtgcatctcgaccagcaccgtca
tacggtgcaggaggcttcacccaactttttcgtaaactcgatcacgagtctgaatccccc
gaaatcacccagcaagagaggttcgctgcggaagcagggcagacgccacaacccggggga
ggctttacgcagctactacgcactctgtccagcgagagcgatgctggcttgccgaccgac
catccgtcgccaatggtccagccgccgcccgaagggcccggcgagtttacgcgcatcgtg
tcccgctccgctctgcgggacgctgcgagccgcagagagcatgagaacgtcaaagcgcaa
gacgaatcattcgcacccgagatgcaagcgcaaccgcaaaggtcggcaataaacccgaat
cgaagcgcttcggacccgcagtacctatcaaattcacaacccatgctcgcccccctgccg
ttggagcagtcagagcaggtagccacagcgcccaggtcggcaggtgcgaccgcctctccg
catcaacctctcggtaagctgcagcaatacatacctgtgctcttgatagcgaacttcttt
acgatgtttatagttctagtcctactggtattcattctgctgcgtcatagataa

DBGET integrated database retrieval system