KEGG   Acidobacteriaceae bacterium SBC82: ACPOL_5341Help
Entry
ACPOL_5341        CDS       T05576                                 

Definition
(GenBank) Glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
abas  Acidobacteriaceae bacterium SBC82
Pathway
abas00500  Starch and sucrose metabolism
abas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACPOL_5341
Enzymes [BR:abas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     ACPOL_5341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AXC14591
LinkDB All DBs
Position
5688331..5690757
Genome map
AA seq 808 aa AA seqDB search
MTLLEAEYKWVEGSGAAFGAPGLPPRWTSAAKDTVATAYSASSRVWYTISHGILNEVYFP
TIDRPQIRDMELLISDGETYFQEEKRTLKTKFEYIDSDSPAVRTVGRDPEGRYTLTKEII
SNPHHPVIIVHAVLEGDEKVLCRLKVYSLLAPHLNGGGAGNSARTLEVAGKRSFIAWKDG
ISLAMICDPGFRRTSCGYVGTSDGWQDMQNFKMDWEFGSALDGNIALLGEVDLTHQAGGR
REFTIALGFGYGHHAALSGAMASLATPFDSHLKRYILQWHRAASPLELAVKSHDKGTLLQ
ISHNILLTHEDKTYSGAFIASASIPWGNHKSDEDLGGYHLVWTRDMVQTASALLACGRTD
TALRALVYLACTQKPDGSFAQNFWVDGTPYWTGIQLDEVAFPIMLAWRLWKVDGLGEFDV
FPFVERAAAFLVRYSPITQQERWEENAGYSPSTLAAVIAGLICAADIAKSRHAFEMAHFL
EHYADWIEAHLDEWTVTDEGVLVPEIRRHYMRIRPPSRGEMYYREEVGEGMLRLSNRAPN
ERYDFEAREVVDAGFLELVRYGIRSAHDPLIVDSLKVIDKVLKVETPAGPCWRRYNHDGY
GQRHDGGPYLGWGQGRAWPILTGERGHYELAAGHDPAPFIQALERFASEGGMIPEQIWDE
PSIDGMEIGRPTGAAMPLVWAHAEYLKLLRSALDGRVFERISVVEDRYIGENRHHGHPEI
FKLRRPLKTVRAGSTLRVVAENRFRLLWSVDGWATVNTLESCHVGFPGSFADVSVPEAQS
GTISFTLFWPGENRWEGRNFDVEIVSAG
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgacgttgctagaagcggaatataagtgggttgaaggatccggggcggcgttcggcgca
ccgggattgccgccgcggtggacatcggcggcaaaggacacagtagcaaccgcctattcg
gcgtcgagccgggtctggtacacaatctcccacggcattctgaacgaagtgtatttcccc
accatcgaccggccgcaaatccgcgatatggaattgttgatttccgatggagagacctac
ttccaggaagaaaaacggaccctcaagacgaagttcgagtacatcgactccgattccccg
gcggtgcgaaccgtcggccgcgaccctgagggtcgatacacgctgacgaaggagatcatc
tcaaatcctcaccatccagtcatcattgttcatgcggtgcttgagggcgatgagaaggtg
ctgtgccgtttaaaggtctactcgctgctcgcaccccacttgaacggcggcggcgcggga
aactctgcgcgcaccttggaagtagcgggcaagcgctcgtttattgcctggaaagatggg
atctcgctagccatgatctgcgacccgggcttccggaggacgagttgcggctatgtgggg
acgagcgacggctggcaggatatgcagaatttcaagatggactgggaattcgggagcgcc
ctggatggcaatatcgcgttgctcggcgaggtggatctgacccatcaagccggggggcgg
cgcgagttcacgattgcgctgggcttcgggtatggccatcatgcggccctctccggagcg
atggcctcactggcaacgccgtttgactcccacctgaagcgatacattctgcaatggcat
cgcgccgccagtccgctggaactcgcagtgaagtcgcatgacaaaggaacgctgttacag
atcagccataatattctgctgacccacgaggacaagacgtattccggggcatttatcgcc
tcggcgtccataccttggggaaaccacaagagcgatgaggacctgggcgggtaccatctg
gtttggacgcgggacatggtgcagacggcgtctgccttgctcgcctgcgggcgcaccgac
actgcgcttcgagcgctggtttacctggcctgtacgcagaagccggacgggagcttcgcg
cagaacttctgggtggatggcacgccctactggacgggaattcaacttgatgaggtcgcc
ttcccgatcatgctggcgtggcgtctttggaaggtcgatggcttaggcgaattcgatgtt
tttccttttgtcgagcgggcggcggcgttcctggttcgatattctcccatcactcagcag
gaacgatgggaggaaaacgctggatattctccctcaactttggcggcggtcatcgccggc
ttgatttgcgcggccgacatcgccaagtcccgccatgccttcgaaatggcccactttctc
gaacattatgctgactggatcgaagcccatctagacgaatggacggtcacggatgagggg
gtcctggttccggagattcgacggcactacatgaggatccggccaccgagccggggagag
atgtactaccgggaggaggtcggcgaagggatgctgcggctctccaaccgggcgcctaac
gagcgctacgacttcgaggcgcgcgaagtcgtggacgccggattcctggaactggtccgc
tacggcattcgaagtgcgcacgatccgttgatcgtcgattcgcttaaagtcatcgacaaa
gttctcaaggtagagacgcctgccggtccgtgctggcggcggtataaccacgatggttat
ggacagcggcatgatggaggtccatacctgggctgggggcaaggacgtgcgtggccgatc
ttgaccggggagcgcggccactatgagttggccgccggacatgatccggcacccttcatc
caggcgctggaacggttcgcctcggagggggggatgattcccgagcagatctgggatgag
ccctcaatcgatggcatggagatcgggcgtccgaccggggctgcgatgccgttggtctgg
gcccacgcggagtacctgaagctgcttcgttcggcattggatgggcgggtctttgaacga
atttcggtcgtggaagatcgctatatcggggaaaaccggcaccatgggcatccggagata
ttcaaactgcggcgcccgctcaagacggttcgtgccggatccacgctccgggtggtcgct
gaaaaccgcttccgcttactatggagtgtggatggttgggcgacggtgaatacgctggaa
tcctgccacgtaggatttccggggtcctttgccgatgtcagcgttccggaggcgcaaagt
ggcaccatatcgtttaccctgttctggccgggagagaaccgctgggagggtcgcaacttc
gatgtcgagattgtgtctgcgggctga

DBGET integrated database retrieval system