KEGG   Acidobacteriaceae bacterium SBC82: ACPOL_5689Help
Entry
ACPOL_5689        CDS       T05576                                 

Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
abas  Acidobacteriaceae bacterium SBC82
Pathway
abas00564  Glycerophospholipid metabolism
abas01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ACPOL_5689
Enzymes [BR:abas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ACPOL_5689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 Pyr_redox_3 FAD_binding_3 HI0933_like NAD_binding_8 Lycopene_cycl Pyr_redox 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: AXC14935
UniProt: A0A2Z5G8F9
LinkDB All DBs
Position
complement(6057931..6059484)
Genome map
AA seq 517 aa AA seqDB search
MLARLQSHSEPWDMVIIGGGATGVGIAVDGASRGLDVLLLEREDFGKATSSRSTKLVHGG
VRYLEQGNVSLVMEALKERGILRQNAPHLVHDLAFVVPNYSWWETPFYGIGMKVYDLLAG
KYGFGRSRILSLEETLEKLPNLQRDGLRGGVVYYDGQFDDSRLLMHLAQTAADHGATLLN
YAPVTELAKDSAGYISGVIAEDAESGERFEIKAQVVVNAAGIFADSVRQMADPAAAKMLA
PSQGIHLVFDGSFLLGDTAIMVPHTSDGRVLFAIPWHGHTLVGTTDTEIPGPSYDPLPFD
EEIEFVLETAGQYLSRPPSRSDVLSVYVGIRPLVKAAGGGSGSTSALSRDHTIHVDQSGL
LTIVGGKWTTYRHMAEDCVNHAITLGKLPDKECVTRTLKIHGYLEGVDDLDSFAVYGSDL
EKVRAIAAQDPTLSEALHPALPYIGAEVVWAVREEMARTLDDVLSRRLRALFLNAKAAID
MAPAVARIMAAELGLGEDWLNDEVARFQAFAHKYEVV
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctggctcgactccagagccacagcgagccctgggacatggtcatcatcggcggtggc
gcgactggggtaggcattgccgtcgacggtgcaagccgaggactcgacgtcctgctgctc
gaacgcgaagattttgggaaagccacatcgagccgtagcaccaagctggtgcatggtggg
gttcgctatctcgaacaaggaaacgtttcgctcgtaatggaggcgctcaaggagcgagga
attttacgtcagaatgctcctcacctggtccacgacctggcttttgtcgttcccaactat
tcatggtgggagacgcctttctatggcatcggcatgaaggtgtacgatcttttggcagga
aagtacggcttcggacgctcgcgcatcctttctctggaggagacgctggagaagctgccc
aatctgcagcgggatgggttgcgcggcggcgttgtctactacgacggccagttcgacgat
agccgcttgttgatgcacctggctcagacagcagccgaccatggtgcaaccctactgaac
tatgctccagtaaccgaactcgccaaggacagcgcaggctatatctccggcgtgatagcg
gaagacgcggagagcggagagcggttcgagatcaaagctcaggtggtcgtgaacgcggcg
ggtatctttgccgactccgtgcgccaaatggcggatcccgcagcagcgaagatgctggcg
ccaagccagggcatccacctcgtctttgatgggtcattcctgctcggggatactgcgatc
atggtgccccatacgagcgacggcagagttctctttgcaatcccatggcatggtcacacg
ctcgttggcacgacagataccgagatcccggggccatcctatgatccgcttccattcgat
gaggagatcgagtttgtgcttgaaacggccggccaatacctgagccgtcctccctcgagg
agcgatgtcctgagtgtctatgtggggatccggcctttggtcaaggcggcgggcggcggg
agcgggtccacgtcggcgctgtcgcgcgatcacacgattcatgttgaccaatccggatta
ctgacaatcgttggcgggaagtggactacttatcgacacatggcggaagattgcgtgaat
catgccatcaccctcggcaaattgcctgacaaggaatgtgtgaccaggacgctgaagatc
catggttatctggaaggagtagacgatctggattcctttgcagtgtatggttcggatctg
gagaaggtccgcgcgatcgccgcgcaagatcctacactatctgaggccttgcatcctgca
cttccttacattggcgcggaggtagtttgggcagtccgtgaggagatggcgaggaccctt
gatgatgtcttgtcccgccgtctacgcgctttgtttctgaatgccaaagccgcgattgat
atggcgccggctgtggcgagaattatggctgccgagcttggtctaggcgaagattggttg
aatgatgaggttgccaggttccaggcattcgctcacaaatacgaagtagtttag

DBGET integrated database retrieval system