KEGG   Brevefilum fermentans: CFX1CAM_0107Help
Entry
CFX1CAM_0107      CDS       T04881                                 

Definition
(GenBank) putative L-iditol 2-dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
abat  Brevefilum fermentans
Pathway
abat00040  Pentose and glucuronate interconversions
abat00051  Fructose and mannose metabolism
abat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CFX1CAM_0107
   00051 Fructose and mannose metabolism
    CFX1CAM_0107
Enzymes [BR:abat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     CFX1CAM_0107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: SMX53173
UniProt: A0A1Y6K0J4
LinkDB All DBs
Position
I:complement(121882..122937)
Genome map
AA seq 351 aa AA seqDB search
MNTKSKNMIGLYKTHKGVGNLELRETSIPVIKPNEVLIEIMAAGICGTDIHIKHDLFPYY
PPVILGHEFSGKILEIGQEVTLFKPGDRVVGEPHTRACGKCELCRTGNIQICAQKRSPGW
GIDGAFAKYLAFPEHLLHALPDNISYEEGALIEPAANAVQDVLERAKVEPNDFVVVNGPG
PIGLLSAMAARAGGAGTVVLVGTSSDKRYRIPVAEKLGFDRFIIADEQDGIKAIEEMTNG
RGADLVVEASGSARAIAASVGMVRRLGRICQIGIVGKPEIAFPWDLAGWKGCTIYFNLST
GYTCWDRTIGLVASGKIDVKTLITHSYPLVEWERAFEVVESQEAIKTLIIP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaaagtcaaaaaatatgatcggtttgtataagacacacaaaggtgttggcaac
cttgaattgcgggaaacaagcattcctgttattaaacctaacgaggtcttgatagagata
atggcagctggtatttgtggaacggatattcatatcaaacatgacctttttccctactac
cctccagttatcttgggtcacgaattttcaggaaaaattctcgagattggacaagaagtt
acgctgttcaaaccgggggacagggttgtgggcgaaccgcatacccgggcttgtggaaaa
tgcgagttgtgtcgaactggaaatatccaaatctgtgctcaaaaaagatctcctgggtgg
ggaatagatggggcttttgcaaaatacctggccttccctgagcatctacttcatgctcta
ccggataatattagttatgaagaaggcgcattaattgaaccagccgcaaatgcagttcag
gatgttttggaaagagcaaaagttgaacccaacgacttcgtcgttgttaatggccctggc
ccaattggcttgctttctgcaatggctgcaagagctggtggagcaggcacagttgtattg
gtgggaacctcttctgataaaagatatcgcatacctgttgctgagaaacttgggtttgat
cggttcataattgcagacgaacaggacggaatcaaggcaattgaggaaatgactaatgga
agaggtgccgatcttgttgttgaagcaagcggatcagctcgcgcaattgcagccagtgta
gggatggtaagacgcttgggccgcatttgccaaattggcattgtaggcaaacctgaaata
gcttttccatgggatctggcaggctggaagggctgtaccatatattttaatctcagcacg
ggttatacctgctgggaccgcaccattggtttagttgcgtctggaaaaattgatgttaaa
accttaatcacgcattcatatccattggtcgaatgggaaagagcctttgaagttgtcgaa
tctcaggaagcaatcaaaacgctgattatcccatga

DBGET integrated database retrieval system