KEGG   Acinetobacter baumannii AB030: IX87_12785Help
Entry
IX87_12785        CDS       T03375                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
abau  Acinetobacter baumannii AB030
Pathway
abau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
abau01100  Metabolic pathways
abau01110  Biosynthesis of secondary metabolites
abau01130  Biosynthesis of antibiotics
abau01230  Biosynthesis of amino acids
Module
abau_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:abau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    IX87_12785 (aroK)
Enzymes [BR:abau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     IX87_12785 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 AAA_5 TsaE Cytidylate_kin AAA_22 AAA AAA_16 Cytidylate_kin2 AAA_28 Mg_chelatase dNK CHDNT ABC_tran RNA_helicase Ploopntkinase3 AAA_30
Motif
Other DBs
NCBI-ProteinID: AIL79458
UniProt: V5V963
LinkDB All DBs
Structure
PDB: 

Position
complement(2470105..2470674)
Genome map
AA seq 189 aa AA seqDB search
MKAIEIGGALPSKAFETLPNIYLVGPMGAGKTTVGRHLAELLGREFLDSDHEIERKTGAT
IPWIFEKEGEVGFRTRETVVLNELTSRKALVLATGGGAITQAPNREFLKQRGIVVYLYTP
VELQLQRTYRDKNRPLLQVENPEQKLRDLLKIRDPLYREVAHYTIETNQGAARDLAQKIL
QLILSNKLK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaattgaaataggtggcgccttgccaagcaaagcgtttgaaaccctaccaaat
atttatttggtagggcccatgggggcaggaaaaacaaccgttggacgtcatttagcagaa
ctattagggcgtgaatttttagatagtgatcatgaaattgaacgcaagacaggggccact
attccctggatttttgaaaaagagggagaagtcggcttccgtacgcgtgaaactgtcgtt
ttaaatgagcttacttcacgtaaggcattagtacttgccacaggtggcggtgctattact
caggcgcctaatcgggagtttttaaagcaacgtggaatcgttgtttatctatatactcct
gtcgaattacaactacaaagaacctatcgcgataaaaatagacctttattacaagttgaa
aatcctgaacaaaaattgcgggatttattaaagatcagagatcctctgtatcgtgaagtt
gcacactatacgattgaaacgaatcaaggtgctgcacgtgatcttgcccaaaagattttg
caacttattctatcgaacaagttaaaatag

DBGET integrated database retrieval system