KEGG   Acinetobacter baumannii AB030: IX87_19400Help
Entry
IX87_19400        CDS       T03375                                 

Definition
(GenBank) diaminohydroxyphosphoribosylaminopyrimidine deaminase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
abau  Acinetobacter baumannii AB030
Pathway
abau00010  Glycolysis / Gluconeogenesis
abau00020  Citrate cycle (TCA cycle)
abau00620  Pyruvate metabolism
abau01100  Metabolic pathways
abau01110  Biosynthesis of secondary metabolites
abau01120  Microbial metabolism in diverse environments
abau01130  Biosynthesis of antibiotics
abau01200  Carbon metabolism
Module
abau_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IX87_19400
   00020 Citrate cycle (TCA cycle)
    IX87_19400
   00620 Pyruvate metabolism
    IX87_19400
Enzymes [BR:abau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     IX87_19400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AIL80694
LinkDB All DBs
Position
3817000..3818481
Genome map
AA seq 493 aa AA seqDB search
MEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGDTLPVGGLI
AVCADNEVSDAEIEKFIASLGGSAAQAPSEQSKAETSAPIAEKAEQPQTVAASASAPVKV
AKGDYAVPESLKGYQTSNELFATPHALKLAEKHNVNLAKVTGSGSEGRISVQDIQKAVQA
SGGQWPDVRQQTQAKVVKSTADDSQVLATPVARRLAKQWGINLNDCRVSGTRGRVCKEDV
EAVYYRNNPVSVSEQPVQCAAQPQSTVTTVAMNGMRKAIASRLQTAKRNAPHFRLVVDLN
VEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQADIS
VAVAIPNGLITPIVKAANHKSLAQISDDMRDLATRAKTGKLQPDEFQGGSFSISNLGMLG
IKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKFLAS
FKQFVENPALILV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaggcacgatcgcccaatggttgattaaagagggtgatagctttaataagggc
gatgaaatttgtgaaattgaaaccacaaaaatcgtcaatgtgttagaagcgccttttgct
ggaacgctccgtaaaattttagcgaaagatggtgatactttacctgttggtggtcttatt
gccgtatgtgctgataatgaagtttctgatgcagaaattgaaaagtttatcgcatcatta
ggtggttcagcagctcaagcaccttcggaacaaagtaaagcggaaacatctgcacctatt
gctgaaaaagcagaacagccacagactgtagcagctagtgcttcagctcctgtaaaggtc
gctaaaggtgactacgctgtaccagagtcattaaaaggctatcaaacatctaatgagttg
tttgcaacgccgcatgccttgaagcttgcagaaaaacacaatgtaaacttggcaaaagtc
acaggttctggtagtgaaggacgtattagtgttcaagacatccagaaggctgtacaagcg
tctggtggtcaatggcctgatgttaggcagcaaactcaagctaaagtggttaaatctacg
gccgatgatagccaagttttagcaacgcctgtagcgcgtcgtttagcaaagcagtggggc
attaacctaaatgattgccgtgtttcaggtactcgtggccgtgtctgtaaagaagatgtt
gaggcagtttactatcgtaataacccagtgtcggtaagtgaacaacctgtacaatgtgca
gcccaaccacaatcaaccgttacgacggtggcgatgaatgggatgcgtaaagcgattgct
tcacggttacagactgcaaaacgtaatgcaccgcatttccgcttggtggtcgatctcaac
gtagaggctttgcaaaaattacgtaagcagattaatgagactgttccacaagtgaaactt
tctattaatgacatgctaattaaggcagctgccgccgcactgattaaagtacctgaggtg
aatgttcaatttgatgaggcgacccaatcaattttacagttctctcaagcggatatttcg
gtggccgtagcgattccaaacggtttaattacacccattgtaaaagcagcaaatcataag
tctttagcacaaatttccgatgacatgcgtgatttggcaacgcgtgctaagactggcaag
ttacaacctgacgagtttcagggaggcagctttagcatttcaaatttaggaatgttaggc
attaaacagttcgatgccattatcaacccaccgcaaggtgcaattatggcattaggtgct
tcggaatctcgcgctgttgttgaaaatggcaatgtagtggttcgtgagattgtcacagcg
acgttgtcatgcgatcaccgagttattgatggcgcagttggggcgaaattcttggccagc
tttaagcagtttgttgaaaaccctgctttaattttggtgtag

DBGET integrated database retrieval system