KEGG   Acinetobacter baumannii AB030: IX87_19415Help
Entry
IX87_19415        CDS       T03375                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
abau  Acinetobacter baumannii AB030
Pathway
abau00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:abau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    IX87_19415
Enzymes [BR:abau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     IX87_19415
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     IX87_19415
    1.1.1.-  
     IX87_19415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C FAD_binding_3 TrkA_N
Motif
Other DBs
NCBI-ProteinID: AIL80697
UniProt: A0A0E1FND7
LinkDB All DBs
Position
3820737..3821795
Genome map
AA seq 352 aa AA seqDB search
MKAARFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPITMGHEFSGVVYAVGEGVDDIEIGQHVVVEPYIVADDVPTGPGDNYHLSKNMNF
IGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAFVRSGAKAGDTALVG
GAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVMKITNG
DGVDVAFECSSVNKVLDTLVAAVKPTGVIVIVSIWSHPASINVHSVVMKELDVRGTIAYV
NDHQETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVHP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcgcgtttttatgacagaggtgatatccgtattgaagatattcctgaacca
gaagtcactcccggcactgtaggcattaaggtagcctggtgtggaatctgtggtacagat
ttgcacgaatttatggaaggaccaatttttattccaccttgtggacatccgcatcctatt
tcaggtgaatctgcgccaattaccatgggacatgaattttcaggtgtagtctatgccgta
ggtgaaggtgtggatgatattgaaattggtcagcatgtcgtcgtagagccttatattgtg
gccgatgatgtgccgactggaccgggtgataattatcatctttctaaaaatatgaacttc
attggtttaggcggtcgtggtggtggtttatcggaaaaaattgcagttaaacgccgttgg
gtgcatccaatttccaataaaattccgctagatcaggcagccttaattgaaccgttatcg
gtgggtcatcatgctttcgtacgtagtggtgcaaaagctggtgatactgcactggttggc
ggtgcaggtccaattggtttgttgctttcggcaattttaaaagctaaagggcttaaggtc
atcattaccgaactaagtgcaaaacgtaaagaaaaagccaaagagtcgggagtcgcagat
tatattttagacccgtcagaagttgatgttgtttctgaggtcatgaaaattactaatggc
gatggtgtcgacgtcgcgtttgaatgtagtagcgttaacaaggtattagataccttggtt
gcagcagtaaaaccgacaggcgttattgttattgtttcaatttggagccacccagcatca
attaatgtgcacagtgttgtaatgaaagagctcgatgtaagaggcacaattgcctacgta
aatgaccatcaagaaaccattaaactggtcgaagaaggtaaaataaatctggaacctttt
attacccagcgcattcaacttgatgatttgatttcacaaggttttgaaaccttaattcat
aacaatgaatcagccgttaagattattgtacatccataa

DBGET integrated database retrieval system