KEGG   Acinetobacter baumannii AB030: IX87_19435Help
Entry
IX87_19435        CDS       T03375                                 

Definition
(GenBank) NAD(FAD)-dependent dehydrogenase
  KO
K17218  sulfide:quinone oxidoreductase [EC:1.8.5.4]
Organism
abau  Acinetobacter baumannii AB030
Pathway
abau00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:abau00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    IX87_19435
Enzymes [BR:abau01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.5  With a quinone or similar compound as acceptor
    1.8.5.4  bacterial sulfide:quinone reductase
     IX87_19435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF442 Pyr_redox_2 DAO Lycopene_cycl Thi4 NAD_binding_9 HI0933_like NAD_binding_8 FAD_binding_2 Rhodanese
Motif
Other DBs
NCBI-ProteinID: AIL80701
UniProt: A0A0E1FSL0
LinkDB All DBs
Position
3824992..3826647
Genome map
AA seq 551 aa AA seqDB search
MELKRVNQDFYVAGQITADDIAKIADQGIKTLICNRPDGEGADQPNVIEIEEAAQQYGLN
LIYQPVTSGKITDQQVTEFKQLYQNAQKPVLAYCRSGMRAISLWALAEVAPQDVALLVES
VNKLGFNLKGLVPRILKRDHEPATIPCYSVVVVGAGAAGISVASSLLCREPHLDIVIIDP
ADTHYYQPGWTMVGGGIFKPQVTARSMTSVIPSKVKWMKAAVAGFDPEHNQVILEGCQPI
QYKALVVCPGLKLNWHGIEGLVETLGKNGVTSNYRYDLAPYTWELVQQLNGGKAIFTQPP
MPIKCAGAPQKAMYLSADYWLKQGKLKDISIHFYNTGAVLFGVQEYVPALMQYVEKYGSE
LHFNHQLVKVDGPAKKAWFKVVNDENAALVETDFDMLHVVPPQQAPDFIRASTLTDEAGW
VSVNPQTLQHTQHANIFALGDVMNAPNAKTAAAARAQAPIVAVNVIAQLKGEQNFCEYNG
YGSCPLTVERGKIVLAEFGYGGKLLPSFPKWVIDGQKPSRLAWLLKEQILPPIYWQGMLK
GREWMVKPERG
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggaacttaaacgagttaatcaagatttttatgttgctggccagattactgccgacgat
attgcgaaaattgcagatcaaggaataaaaactctgatatgtaaccgtccagatggagaa
ggtgcagatcaacctaacgtgattgaaattgaagaagcagctcaacaatatggtctaaat
ctaatctatcaacctgttaccagtggtaaaattaccgatcaacaagttaccgagtttaag
cagctttatcagaatgcccaaaaacctgttttagcgtattgccgttctggtatgcgtgca
atcagtttgtgggctttggctgaagttgccccacaagatgtagcactgttagttgaatcg
gttaacaaacttggttttaacttaaaaggcttagtgccacgtattttaaaacgtgatcat
gaaccagccacaattccttgttatagcgttgtggttgtgggcgctggagcagcaggaatt
tctgtagcgtctagtcttttatgtcgtgaacctcatttagatattgtcattattgatccc
gcagatacacattattatcaaccgggctggaccatggttggtggcggtattttcaaacca
caagtaaccgcacgctcaatgacaagtgtgataccttcaaaagtaaaatggatgaaagct
gcggttgctggattcgacccagagcataatcaggttattttggaaggatgccaacctatt
caatataaagctttggtcgtctgtcccggtttaaaactcaattggcatggcattgaaggc
ttagttgaaaccttaggtaaaaatggggtgacgtctaactatcgttatgatttagcgccg
tatacatgggaactggtgcaacagctaaacggtggaaaggcaatctttacccagccacct
atgccgattaaatgtgccggtgctcctcaaaaagcaatgtacctttcagcggactactgg
ttaaagcaaggcaaacttaaagatatctctatccatttttataacactggtgctgtttta
tttggtgtgcaggaatatgtacctgcactaatgcaatacgttgaaaaatatggttcagaa
cttcattttaaccatcaacttgtcaaagtagacgggcctgcaaagaaagcatggttcaaa
gtggtgaatgatgaaaatgcagcattggtcgaaacagatttcgatatgttgcatgttgtt
ccaccacaacaagcgcccgactttattcgtgcaagtactcttactgatgaagccggctgg
gtgagtgtgaatcctcaaaccctacaacacacacagcacgccaatatttttgctttaggt
gatgtgatgaatgcgcctaatgccaaaactgctgctgcggcacgggcacaagctccgatc
gttgcggttaatgttatagcccagctcaaaggtgagcaaaacttctgcgagtacaacggc
tatggctcatgtccactcacagtagagcgtggaaaaatcgttctggctgagtttggctac
ggcggcaaattacttccaagttttccaaaatgggtgattgatggacaaaaaccatctcgt
ttggcatggctacttaaagagcaaattttaccgccgatttactggcaaggcatgctcaag
ggccgcgagtggatggtcaaacctgagcgaggataa

DBGET integrated database retrieval system