KEGG   Alphaproteobacteria bacterium WS11: D5400_01220Help
Entry
D5400_01220       CDS       T05798                                 

Gene name
fabA
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
abaw  Alphaproteobacteria bacterium WS11
Pathway
abaw00061  Fatty acid biosynthesis
abaw01100  Metabolic pathways
abaw01212  Fatty acid metabolism
Module
abaw_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:abaw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    D5400_01220 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:abaw01004]
    D5400_01220 (fabA)
Enzymes [BR:abaw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     D5400_01220 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     D5400_01220 (fabA)
Lipid biosynthesis proteins [BR:abaw01004]
 Fatty acid synthase
  Component type
   D5400_01220 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AZN73500
UniProt: A0A3S9B967
LinkDB All DBs
Position
246063..246575
Genome map
AA seq 170 aa AA seqDB search
MDKKSSYDYEDILRCGRGELFGQGNAQLPLPPMLMFDRITEISETGGEFGKGFVRAEFDI
KPDLWFFPCHFQGDPVMPGCLGLDAMWQLTGFFLGWLGEPGRGRAISTGEVKFTGMVTPE
TKLVEYGIDFKRVLRGRLVLGIAEGWLKADGETIYKASDLRVGLFKDKSA
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggataagaaatccagttacgattacgaggacatcctgcgatgcggccgtggggagctg
ttcggacagggcaatgcgcagcttccgctgccgccgatgctgatgttcgacaggatcacc
gagatttcggaaacgggtggtgagttcggcaaaggcttcgtgcgcgcggagttcgacatc
aagccggatctctggttctttccgtgccacttccagggcgacccggtcatgcctggctgc
ctcggcctcgatgcgatgtggcagctgaccggattctttctcggctggctcggcgagccg
ggtcgtggtcgggcaatctccacgggcgaagtgaagttcaccggaatggtcacgcccgag
acgaagctcgtcgaatacggcatcgacttcaagcgcgtgctgcgcggccgcctcgtgctt
ggcatcgccgagggctggctgaaggccgatggcgagaccatctacaaggccagcgaccta
agggtcggcttgttcaaggacaagagcgcctga

DBGET integrated database retrieval system