KEGG   Alphaproteobacteria bacterium WS11: D5400_01225Help
Entry
D5400_01225       CDS       T05798                                 

Definition
(GenBank) beta-ketoacyl-ACP synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
abaw  Alphaproteobacteria bacterium WS11
Pathway
abaw00061  Fatty acid biosynthesis
abaw00780  Biotin metabolism
abaw01100  Metabolic pathways
abaw01212  Fatty acid metabolism
Module
abaw_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:abaw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    D5400_01225
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    D5400_01225
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:abaw01004]
    D5400_01225
Enzymes [BR:abaw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     D5400_01225
Lipid biosynthesis proteins [BR:abaw01004]
 Fatty acid synthase
  Component type
   D5400_01225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: AZN70074
UniProt: A0A3S9AZE3
LinkDB All DBs
Position
246667..247887
Genome map
AA seq 406 aa AA seqDB search
MRRVVVTGLGIVSSIGNDQEAVTQSLRDARSGISRSEDFAEHGFRCQVWGSPKIDTSELV
DRRAARFLSQGGAWNHVAMQQAIDDAGLEQGDITNEMTGIVMGSGGPSTRTIVEAADITL
KNGSPKRIGPFAVPKAMSSTASATLATWFKIHGVNYSISSACSTSAHCIGNAAELIQLGK
QDIVFAGGHEDLHWSMSNLFDAMGAMSSKYNDTPESASRAYDANRDGFVIAGGAAVLVME
ELEHAKARGAKIYAELVGYGATSDGYDMVAPSGEGAVRCMRQALKTVDGPVDYINTHGTS
TPVGDSKEIGAIREVFGDKIPFISSTKSLTGHSLGAAGAQEAIYSLLMMQAGFLGKSAHI
ETLDPEFEGMPILTERRDDVKIDRVLSNSFGFGGTNATLVFQRYEG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagacgtgtggttgtgaccgggctcggcatcgtgtcctcgatcggcaacgatcaggag
gcggtcacgcagtcgcttcgggacgcccgttcgggcatctcccgctcggaagacttcgcc
gaacacggctttcgctgccaggtctggggttcgcccaagatcgacacgagcgagctggtg
gatcgtcgtgcggcgcgctttctctcccagggcggcgcctggaaccatgtcgccatgcag
caggcgatcgacgacgccgggctcgaacagggcgacatcaccaacgagatgaccggcatc
gtgatgggctcgggcggcccgtccacccgcaccatcgtggaagcggccgacatcacgctc
aagaacggcagccccaagcgcatcggaccgttcgcggtgccgaaggccatgtcgtccacc
gcttcggcgacgcttgccacctggttcaagatccacggcgtcaactattcgatttcgtcg
gcctgctcgacatcggcgcattgcatcggcaacgccgccgaactgatccagctcggcaag
caggacatcgttttcgccggcggccacgaggatttgcactggtccatgtcgaacctcttc
gacgccatgggcgccatgtcgtcgaagtacaacgacacgccggaatccgcttcgcgcgcc
tatgacgccaaccgcgacggcttcgtcatcgccggtggtgccgccgtcctcgtcatggaa
gagctggaacacgccaaggcacgcggcgcgaagatctatgccgaactcgtcggctacggc
gcaacgtcggacggctacgacatggtcgctccatccggcgaaggtgcggtgcgctgcatg
cgccaggcgttgaagactgtcgacggtcccgtcgactacatcaacacccacggcacatcg
acgcccgtcggcgacagcaaggagatcggcgcgatccgcgaagtcttcggcgacaagatc
cccttcatctcgtcaacgaagtcgctcaccggccattcgctcggtgcggcgggcgcgcag
gaggcgatctactcgcttctgatgatgcaggcgggtttcctcggcaagagcgcccatatc
gagacgctcgatcccgagttcgaaggcatgccgatcctgaccgaacgccgcgacgacgtg
aagatcgatcgggttctatcgaactccttcggcttcggcggcaccaacgcgacgctggtc
ttccagcgctacgaaggctga

DBGET integrated database retrieval system