KEGG   Alphaproteobacteria bacterium WS11: D5400_07350Help
Entry
D5400_07350       CDS       T05798                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
abaw  Alphaproteobacteria bacterium WS11
Pathway
abaw00564  Glycerophospholipid metabolism
abaw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abaw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    D5400_07350
Enzymes [BR:abaw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     D5400_07350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 FAD_binding_2 FAD_binding_3 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AZN71115
UniProt: A0A3Q8XN29
LinkDB All DBs
Position
1570287..1571837
Genome map
AA seq 516 aa AA seqDB search
MRSGRGSVSGSKAFDIFIVGGGINGCGIARDAVGRGYSVCLAEMNDFASGTSSWSTKLVH
GGLRYLEHYEFRLVREALMEREVLWGMAPHIIWPLRFVLPHHKGLRPAWLLRLGLFLYDH
IGGRRRLPATKTLDMKRDPAGKPLKPLFSKAFEYSDCWVDDARLVVLNARDAADRGAVIR
PRAKLVSARTEKDGWLLTIEDQASGRREDVRARAVVNAAGPWVDQVLSRAVGRNDVHNVR
LVKGSHIVVRRLFEHDRCYIFQNADGRIIFAIPYEGDFTLIGTTDLDYEGDPKDAAISQA
EIDYLCDAASEYFANPIKRSDVVWTYSGVRPLYDDGASKAQEATRDYVLKRDGANGGPAL
INVFGGKITTYRRLAESMMDKIAEAIGPKGKPWTAGATLPGGDFDAEGFPEQVRRLKGDY
PFLSEQQAHRLVRLYGTRAWKLLGTASQASDLGHHFGADLYELEVAYLIEQEWAQSAEDV
LWRRTKLGLKTGAEEAAALDRYMREKRSGISHSAAE
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
ttgcgaagtgggaggggttccgtgtccggttcgaaggcgttcgacattttcattgtcggc
ggtggcatcaatggatgcggcatcgcgcgggatgccgttggtcgcggctacagcgtctgc
ctggccgaaatgaacgattttgcttcgggcacatcctcatggtcgacgaagctcgtccat
ggcggtcttcgctatctcgagcattacgagtttcgcttggtgcgcgaggcgctgatggag
cgcgaagtgctctggggcatggcgccgcacatcatctggccgctgcgtttcgtgctgccc
caccacaagggtctgcgtcctgcctggctgctgcgcctcgggctcttcctctacgaccat
atcggcgggcgccgccgtcttccggcaacgaagacgctcgacatgaagcgcgatccagcc
ggcaagccgctgaagccgctgttctcaaaagcgttcgaatattccgactgctgggtcgat
gatgcgcgtctcgtggtgctgaacgcccgcgatgcggccgacagaggggccgtcatccgg
ccgcgcgccaagcttgtttctgcccgcacggaaaaggatggctggttgctgacgatcgaa
gatcaggcgagcggccggcgggaagacgttcgggcgcgcgccgtcgtcaatgcggcaggt
ccctgggtcgatcaggttctctcgcgtgctgtcggtcgtaacgatgttcacaatgtgcgg
ctcgtaaagggcagccatatcgtcgtgcggcggcttttcgagcatgaccggtgctacatt
ttccagaacgccgacggccggatcatcttcgccattccgtatgagggcgatttcacgctg
atcggcacgacggatctggactatgagggcgacccgaaggacgctgccatctcgcaggcg
gaaatcgattatctatgcgatgccgccagcgaatatttcgccaatcccatcaagcgcagc
gacgtcgtctggacctattcgggcgtgcggccgctttatgatgacggcgccagcaaggcg
caggaagccacgcgcgactatgtgctgaagcgcgatggtgcgaatggcggaccggcactg
atcaacgtgttcggcggcaagatcaccacctatcggcgcctggcggaatcgatgatggac
aagatcgccgaggcgatcgggcccaagggcaagccatggacggcaggcgcgactttgccg
gggggcgatttcgatgccgaaggctttccggagcaggtgcgccggctcaagggcgactat
ccgttcctgagcgagcagcaggcgcatcgccttgtccggctttacgggacgcgcgcctgg
aagctcctcggcactgcctctcaggcaagcgatcttggccatcatttcggggctgatctc
tacgagttggaggtcgcctacctgatcgagcaggaatgggcgcaatcggccgaggacgtt
ctgtggcgtcgcaccaagctcggcctgaagaccggcgcggaggaggctgccgcgctcgat
cgatacatgcgggaaaagagaagcggcatcagccattcggcggccgagtaa

DBGET integrated database retrieval system