KEGG   Alphaproteobacteria bacterium WS11: D5400_08360Help
Entry
D5400_08360       CDS       T05798                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
abaw  Alphaproteobacteria bacterium WS11
Pathway
abaw00473  D-Alanine metabolism
abaw00550  Peptidoglycan biosynthesis
abaw01100  Metabolic pathways
abaw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:abaw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    D5400_08360
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    D5400_08360
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    D5400_08360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:abaw01011]
    D5400_08360
Enzymes [BR:abaw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     D5400_08360
Peptidoglycan biosynthesis and degradation proteins [BR:abaw01011]
 Precursor biosynthesis
  Amino acid ligase
   D5400_08360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: AZN71278
LinkDB All DBs
Position
1781492..1782418
Genome map
AA seq 308 aa AA seqDB search
MSKGHVAVLMGGFSSERPVSLSSGAACADALEGVGYRVTRIDVDRNVASVLHELKPDVVF
NALHGPFGEDGTIQGILEYLQIPYTHSGVLASALAMDKDQAKKVAKAGGVPVAESRVMDR
HDIGSNHPMKPPYVVKPVNEGSSFGVVIVREGQTHPPQVIGSSEWKYGDRIMVERFIEGR
ELTCAVMGDVALGVIEIIPQGHTFYDFDSKYVPGGSKHEYPAKISPNIYQKIQTLALKAH
RAIGCRGVSRSDFRYDDRFSEEGEVIWLEVNTQPGMTPTSLVPELAQHAGHDFGEFLAWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaggccacgtggccgttcttatgggcgggttctcctcggagcgaccggtcagc
ctgtcgtcgggtgccgcctgtgcggatgcgctcgaaggcgtcggctatcgcgtgacccgc
atcgatgtcgatcgcaatgtcgcaagcgttcttcacgagttgaagcccgacgtcgtcttc
aatgccctgcacgggccgttcggcgaagacggaacgatccaaggcatcctcgaatatctg
cagattccctatacccattccggcgtgctcgcttccgcgctcgccatggacaaggatcaa
gccaagaaggtcgccaaggccggcggcgtgccggttgccgaatcccgcgtgatggatcgc
cacgacattggctcgaaccatccgatgaagccgccctatgtggtgaagccggtcaatgaa
gggtcgagcttcggggtcgtcatcgtgcgcgaggggcagacccatcctccgcaggtcatc
ggttcgtcggagtggaaatatggcgaccgaatcatggtggagcgattcatcgaaggccgt
gaattgacctgcgccgtgatgggcgatgtggcgcttggggtgatcgaaatcatcccgcag
ggccacaccttctatgattttgattccaaatacgtacccggcggatcaaaacacgaatac
cccgcaaaaatttcaccaaatatttaccaaaaaatacagacattggcgctcaaggcacac
agggcaatcgggtgtcgcggcgtcagtcgatcagacttccgttacgacgaccgattttcc
gaagagggcgaggtcatctggctggaggtcaacactcagcctggcatgacaccaacctcg
ctggtgcccgaactcgcccagcatgcagggcatgacttcggcgaattcttggcctggatg
gtggaggacgcatcttgtttgcgttga

DBGET integrated database retrieval system