KEGG   Alphaproteobacteria bacterium WS11: D5400_13295Help
Entry
D5400_13295       CDS       T05798                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
abaw  Alphaproteobacteria bacterium WS11
Pathway
abaw00010  Glycolysis / Gluconeogenesis
abaw00020  Citrate cycle (TCA cycle)
abaw00620  Pyruvate metabolism
abaw01100  Metabolic pathways
abaw01110  Biosynthesis of secondary metabolites
abaw01120  Microbial metabolism in diverse environments
abaw01130  Biosynthesis of antibiotics
abaw01200  Carbon metabolism
Module
abaw_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abaw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D5400_13295
   00020 Citrate cycle (TCA cycle)
    D5400_13295
   00620 Pyruvate metabolism
    D5400_13295
Enzymes [BR:abaw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     D5400_13295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 QRPTase_N HlyD_2 ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: AZN72117
UniProt: A0A3Q8XPE5
LinkDB All DBs
Position
complement(2752937..2754310)
Genome map
AA seq 457 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDKVSSGDVIAEIETDKATMEVEAVDEGTVAKLV
VPAGTEGVKVNAVIAILAEEGEDAAAAAKGDGSEVKTEAKSAQPEQKPEQPKSEEKAEKP
AEAAKPVADQAPVAATPAPKKDGERIFASPLARRLAKESGLDLTAVSGSGPKGRIVKADI
EAAAKGGAPKAAASATQAPSISAAAPAPMAKGASDEQVLKNFAEGSYELVPHDGMRKTIA
KRLVESKQTVPHFYVSVDCELDALLALRKQLNDAAPVRDDKPAYKLSVNDLVIKALALAL
RDVPDANVSWTESAMVKHKHADVGVAVSIPGGLITPIIRKAEEKSLSAISNEMKDLGKRA
RDRKLKPEEYQGGTSAVSNMGMMGVKNFSAVINPPHATILAVGAGEKRPVVKNGELAIAE
VMTVTLSTDHRCVDGALGAELIGAFKRYIENPMGMLV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaacatcacgatgcccgcgctctctcccacgatggaagagggcaatctcgca
aaatggctggtcaaggagggagacaaggtctcctccggtgacgtcatcgctgagatcgag
accgacaaggcgacgatggaagtcgaagccgtcgacgaaggcacggtcgcaaagctcgtt
gtgccggccggcaccgaaggcgtgaaggtcaacgccgtcatcgccattctggccgaagag
ggcgaagacgccgctgcggccgccaagggcgacggttctgaggtgaaaaccgaggcgaaa
tcggcacagcccgagcaaaagccggaacaaccgaaatccgaggaaaaggcggagaagcca
gcagaagcggcaaagccggtggccgaccaggcgcccgtcgcggctactccggcaccgaag
aaagacggcgaacgcattttcgcctcgccgctcgcccgtcgcctcgccaaggaaagcggc
ctcgacctcaccgctgtctcgggctccggtccgaaaggccgcatcgtgaaggccgatatc
gaggcagccgccaaaggtggcgcgccgaaggcagcggcaagcgcgacgcaggccccgtct
atatcggccgcagcaccggctccgatggcgaaaggcgccagcgacgaacaggttctcaag
aacttcgccgaaggctcctacgagctcgtcccgcatgacggcatgcgcaagaccatcgcc
aagcggctggtcgagtccaagcagaccgttccgcacttctatgtatcggtcgattgcgag
cttgacgcgcttctggcgctgcgcaagcagttgaacgacgccgctcccgtgcgcgacgac
aagcccgcctacaagctttcggtcaacgatctggtgattaaggcactcgccttggccctg
agggacgtgccggacgcgaatgtgtcctggaccgaaagcgcgatggtcaagcacaagcac
gccgatgtcggcgttgccgtgtcgatcccgggcggcttgatcacgccgatcatccgcaag
gccgaggagaagtcgctgtctgcgatttcgaacgagatgaaggatctcggcaagcgcgcc
cgcgaccgcaagctgaagcccgaggagtatcagggcggaacgtccgcggtctccaacatg
ggcatgatgggcgtcaagaacttctccgccgtcatcaacccgccgcacgccaccatcctt
gcggttggcgctggtgagaagcggccggtcgtgaagaatggcgagctggcgattgcggag
gtcatgaccgtcacgctctcgaccgaccatcgctgcgtcgacggcgcgctcggagccgaa
ctgatcggcgccttcaagcgctacatcgaaaacccgatgggaatgctggtctag

DBGET integrated database retrieval system