KEGG   Acinetobacter baumannii ZW85-1: P795_0745Help
Entry
P795_0745         CDS       T02954                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
abaz  Acinetobacter baumannii ZW85-1
Pathway
abaz00473  D-Alanine metabolism
abaz00550  Peptidoglycan biosynthesis
abaz01100  Metabolic pathways
abaz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:abaz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    P795_0745
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    P795_0745
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    P795_0745
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:abaz01011]
    P795_0745
Enzymes [BR:abaz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     P795_0745
Peptidoglycan biosynthesis and degradation proteins [BR:abaz01011]
 Precursor biosynthesis
  Amino acid ligase
   P795_0745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 RimK ATPgrasp_YheCD GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: AHB89874
LinkDB All DBs
Structure
PDB: 

Position
164095..165021
Genome map
AA seq 308 aa AA seqDB search
MSNATKFGKVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAEAFDPQDRSVTELVNYDR
AFIVLHGRGGEDGQIQGVLEWLNIPYTGTGVQGSAIGMDKVKTKQIWQGSDLPTAPYRII
TKETDLDSVIAELGLPVIIKPVHEGSSVGMSKVEKAEDFAAAIEKATQHDAVVMAEKWIT
GREFTISFLNGQPLPVIRLQPPADVAFYDYEAKYQRNDVEYGIPCGLSETEEKKLQALCL
RAFQAVGAEGWGRIDAMQDEQGNFWLLEVNTVPGMTSHSLVPKAAKAVGYSFDELCVAIL
EQTLEGTA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaatgctacaaaattcggcaaagttgccgtgttacttggtgggaaatcggctgag
cgtgctgtgtctttagatagtggtcaggcagttttggacgccttgttacgttcaggtgtt
caggctgaggcatttgatccgcaagaccgtagcgtgactgaacttgtaaactatgaccgt
gcatttattgtattgcatggtcgtggtggtgaagacggtcaaatccaaggtgtgcttgag
tggttgaacatcccttatacaggaacgggtgtacaaggttctgccattggtatggataaa
gtcaaaaccaagcaaatctggcaaggtagtgatttaccaaccgcaccgtatcgcattatt
actaaagaaactgacttggattcagtgattgctgaattggggttgcctgtcattatcaag
cctgtacatgaaggttcaagtgtaggcatgagtaaggttgagaaagctgaagattttgcg
gcagcaattgaaaaggcaactcagcacgatgctgtagttatggcagaaaagtggattaca
ggacgcgaatttacgatttcattcttaaatggtcagcctttaccagttattcgtttgcag
ccaccagcagatgttgctttctatgactatgaagcaaaatatcaacgtaatgatgttgag
tatggcattccttgtggtcttagcgaaactgaagagaaaaaactacaagctctatgttta
cgcgctttccaagccgtaggtgcagaaggctggggacgtattgatgcaatgcaggatgag
caaggtaatttctggcttttagaagtaaatactgtgccaggcatgaccagtcattcgctt
gtaccaaaggctgctaaagcagtaggttatagctttgatgaattgtgtgttgcaattctt
gagcaaacattggaaggtacggcttaa

DBGET integrated database retrieval system