KEGG   Acinetobacter baumannii ZW85-1: P795_11480Help
Entry
P795_11480        CDS       T02954                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
abaz  Acinetobacter baumannii ZW85-1
Brite
KEGG Orthology (KO) [BR:abaz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    P795_11480
Enzymes [BR:abaz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     P795_11480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO FAD_binding_3 AlaDh_PNT_C Thi4 K_oxygenase NAD_binding_8 FMO-like Cytochrom_C_2 Spermine_synth Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AHB92021
LinkDB All DBs
Position
2485804..2487369
Genome map
AA seq 521 aa AA seqDB search
MLDQNIKTQLKAYLERLESPIELVAALDESDKAAQIKELVTEIAELSDKVTARFDGNNTR
RPSFGVAKAGEQPRVFFAGLPMGHEFTSLILALLQASGYAPKVSDEVLNQIKGLNLKANF
DVFVSLSCHNCPDVVQALNLIAIYNPNTTATMIDGAFFQDEVEQRKIMAVPMVFQDNEHI
GQGRMTLEEIVAKLDTNSAEKNAAALNAKDAFDVLVIGGGPAGATAAIYAARKGINTGIV
AERFGGQVMDTMDIENFTSVQKTQGPKFAAEMEAHVREYDVDIMNLQRVSKITGADQTAN
GLVEVELENGAKLESKTVILSTGARWREMNVPGEAEYRTRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLVEFDTKLRADQVLQNKLNSLPNTTVIMNALSTEVLGD
GSQVTGLKYKDRATDEEHVVELAGIFVQIGLLPNTDFLKDSEVELTNRGEIIVNDRNETN
VKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYIIRSGQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaaaacattaaaactcaattaaaagcttacctagaacgtttagaaagtcca
atcgaattagttgctgctttagatgaatcagacaaagctgctcaaattaaagaattagta
actgaaatcgctgagctttctgacaaggtaacagcccgttttgacggtaataatacacgt
cgtccaagctttggtgtggctaaagcaggtgaacagcctcgtgtgttctttgcaggctta
ccaatgggccatgagtttacctctttgatcttggctctgttacaagcgtctggctatgca
cctaaagtgtcagatgaagttttaaatcagattaaaggtttaaacctcaaagctaacttt
gatgtattcgtatcgcttagctgtcataactgtccggatgtagtacaggcgcttaacctg
attgccatttataacccgaacaccacggcaaccatgattgatggtgcattcttccaagac
gaagtggaacaacgcaaaatcatggctgtaccgatggtattccaggacaatgaacacatt
ggtcaaggtcgtatgacccttgaagagattgtggcaaaacttgataccaactcggctgaa
aaaaacgcagcagcactcaatgccaaagatgcgtttgatgtattggtgattggtggtgga
cctgcgggtgcaacagctgcaatctatgcggcacgtaaaggcattaacacaggtatcgtg
gctgaacgctttggtggtcaggtcatggataccatggacattgaaaacttcacttctgtg
caaaagactcaaggtcctaagtttgctgctgaaatggaagcacatgttcgtgaatacgat
gtggatatcatgaacctgcaacgtgtcagcaaaatcactggtgcagaccaaacagcaaat
ggcttggttgaagttgaacttgaaaacggtgcaaaacttgaatcgaaaactgtgatcctt
tcaacaggtgcacgttggagagaaatgaatgtaccgggtgaagctgaataccgtacccgt
ggtgttgcttactgcccacactgtgatggtccattgttcaaaggcaaacgtgttgccgtg
attggtggcggtaactcaggtgttgaagcggcgattgaccttgcaggtattgttgagcat
gtaactctggttgagtttgacactaaacttcgtgctgaccaagtcttgcaaaacaagtta
aatagcttgccaaacaccacagtgattatgaatgccttaagtacagaagtgttaggcgac
ggttcacaagtaaccggtcttaaatataaagaccgtgcaactgatgaagagcatgtggta
gagcttgcagggatctttgtacagattggtttacttccaaacactgacttcttaaaagac
agtgaggttgagttaaccaaccgtggcgagatcattgtcaatgaccgcaacgaaaccaat
gtaaaaggtgtatttgctgcgggtgactgtaccactgtaccttacaagcaaattattatt
gctacaggtgaaggcgctaaagcatcactctctgcgtttgattacatcattcgttctggg
cagtaa

DBGET integrated database retrieval system