KEGG   Acinetobacter baumannii ZW85-1: P795_1395Help
Entry
P795_1395         CDS       T02954                                 

Definition
(GenBank) penicillin-binding protein 3
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
abaz  Acinetobacter baumannii ZW85-1
Pathway
abaz00550  Peptidoglycan biosynthesis
abaz01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:abaz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    P795_1395
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    P795_1395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:abaz01011]
    P795_1395
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:abaz03036]
    P795_1395
Enzymes [BR:abaz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     P795_1395
Peptidoglycan biosynthesis and degradation proteins [BR:abaz01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   P795_1395
Chromosome and associated proteins [BR:abaz03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    P795_1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer TMCO5
Motif
Other DBs
NCBI-ProteinID: AHB90004
LinkDB All DBs
Position
305747..307579
Genome map
AA seq 610 aa AA seqDB search
MVDKRTKQTRKKQQSISEKPSLAFDMWRFYLLWAVVLLCFVVLIARAFYVQVINKDFLQN
KANANILRTERIEAMRGVISDRHGVPLAISSPIMKIVIDPRDYFETKHLYDQITAELKQD
PNNRKLKRQLPDKNLNLDELADVVGVDRTDLKKQMNARPRSRYLVLKKEVPPQQADLIMK
GNFQGVYAEKTYKRYYPQPQPNAQIIGLTNSEGQGIEGLEMQLNKQLSGVDGEQKIIRDK
RGNRLKVSEVIREGEPGENITLSIDSRLQYIMYRELTAAGVANNARSATAIAVDVKTGEI
LAMTSWPSYNPNDKNGLSNKDAMRNRGAIDMFEPGSTMKPFTISAALETGQYTPNTIVNT
SPGSMRLGWHTIRDTHNYGALTVSGVIIKSSNVGSAKIALSLPKETLPSFFNRVGFGKRS
AVRFPGESSGLVLPVNKLNSSQIGTMAYGYGLNATILQLAQGYAMLANHGVKMPLSLHKL
DQPPKGEQVLNPKIADQVLLMLEQVTMPGGTAKQANIPGYRVGGKTGTAHKLRADGKGYS
NNEYRALFAGVAPISDPRLAVIVVVENPQGRYYGGLVAAPVFARIMQESLRLMNVPLDKP
LNTPENPIRR
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggtagataagcgaacaaagcaaacacgaaaaaaacagcagtctatttcggaaaaacca
agtcttgcctttgatatgtggcggttttatctgctctgggcagtagtgctactgtgtttt
gtggtattaattgcacgtgcattttatgttcaagtcattaataaagactttttgcaaaat
aaggccaatgccaatattttgcgtactgaacgtatagaggctatgcgtggagtgattagt
gatcgccacggtgtacctttagcgattagtagtccaatcatgaaaatcgtgattgatccg
cgtgattattttgagaccaagcatttatatgatcaaattacggctgaactaaaacaagat
ccaaacaaccgtaaattaaaacgtcagttgccagataaaaatttaaaccttgatgaactt
gccgacgtggtgggtgttgatcgtactgatcttaaaaaacagatgaatgcgcgtccgcgt
tcccgctatcttgttttgaaaaaagaagtgcctcctcagcaagctgacctcattatgaaa
ggtaatttccaaggggtgtatgcagaaaaaacttataaacgttattacccgcaacctcag
ccaaatgctcaaattattggtttgaccaatagtgaaggtcaagggatcgaaggcttggaa
atgcagttgaataagcaactgtcaggtgtagacggtgagcaaaaaattattcgcgataag
cgtggtaaccgtttaaaagtttctgaggtaattcgtgagggtgaaccaggtgaaaatatc
actttaagtatcgactcacgtttgcagtacattatgtaccgtgaattaacggctgcaggt
gtggctaacaatgcgcgttcagcaacggcgattgcagttgatgttaaaacgggtgaaatt
ctggcaatgaccagttggccatcttataacccgaatgataagaatggcttatcaaataaa
gatgctatgcgtaaccgtggtgcgatcgatatgttcgagccaggttcaaccatgaaacct
tttactatttctgcagctttagaaactggtcaatatacgccaaatacgattgtaaatacc
tctcctggctcaatgcgtttaggctggcatactattcgtgatacccataactacggggct
ttgactgtaagtggtgtcattattaagtcttcaaacgtgggttctgcaaaaattgcatta
tcacttccgaaagaaaccttgccgagcttctttaatcgtgttggttttggtaagcgttct
gcagtaaggttccctggggaaagttcaggtctggttttacctgttaataaattaaactct
tctcaaatcggaaccatggcatatggttatggcttaaatgcgacaatccttcaattggct
caaggttatgccatgcttgcaaatcatggtgtcaaaatgccattaagcttgcataaacta
gatcagccacctaaaggtgagcaagttttaaatccgaaaattgccgatcaagttttgtta
atgcttgaacaagtgactatgccgggtggtactgcaaaacaagccaatattcctggttat
agggtaggtggtaaaacaggtaccgcacataaattgcgtgcagatggtaaagggtattca
aataatgagtatcgtgccttatttgcgggtgtcgctccaattagtgatccacgtttagcc
gttattgtagtggtggaaaacccacaaggtcgttattacggtggtttggttgccgctcca
gtttttgctcgtattatgcaagagtcgttgcgcttaatgaatgtgccgcttgataagcca
cttaatactccagaaaatcctattcgcaggtaa

DBGET integrated database retrieval system