KEGG   Acinetobacter baumannii ZW85-1: P795_4550Help
Entry
P795_4550         CDS       T02954                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
abaz  Acinetobacter baumannii ZW85-1
Pathway
abaz00020  Citrate cycle (TCA cycle)
abaz00480  Glutathione metabolism
abaz01100  Metabolic pathways
abaz01110  Biosynthesis of secondary metabolites
abaz01120  Microbial metabolism in diverse environments
abaz01130  Biosynthesis of antibiotics
abaz01200  Carbon metabolism
abaz01210  2-Oxocarboxylic acid metabolism
abaz01230  Biosynthesis of amino acids
Module
abaz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abaz_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:abaz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    P795_4550
  Metabolism of other amino acids
   00480 Glutathione metabolism
    P795_4550
Enzymes [BR:abaz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     P795_4550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AHB90635
LinkDB All DBs
Position
988217..990454
Genome map
AA seq 745 aa AA seqDB search
MAGEKSTIIYTLTDEAPLLATYSLLPIIETFTKPAGIEIVKSDISVAARVLAEFADYLSE
EQKVSDNLAELGRLTQDPDTNIIKLPNISASVAQLTACIKELQSKGYAIPDYPENPATEE
EKTIKARYGKCLGSAVNPVLREGNSDRRAPAAVKNYAKKHPHSMSEWKQWSQTHVSHMEE
GDFYHGEKSMTLDRPRNVKMELITNSGKSIVLKPKVALQEGEIIDSMFMSKKALCDFYEK
QLDDCREAGILFSLHVKATMMKVSHPIVFGHCVKIYYKEAFEKHGKLFDELGINVNNGMA
GLYEKIETLPTSLREEIIEDLHACQEHRPALAMVDSAKGITNFHSPNDIIVDASMPAMIR
AGGKMWGADGKQYDAKAVMPESTFARIYQEMINFCKWHGNFDPKTMGTVPNVGLMAQKAE
EYGSHDKTFEIPEAGIANITDLDTGEVLLTQNVEEGDIWRMCQVKDAPIRDWVKLAVTRA
RNSGMPAIFWLDPYRPHENELIKKVQKYLKDHDTTGLDIQIMSQVRAMRYTLERVVRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEEN
HLRWDSLGEFLALAVSLEEMGIKENNARAKLLAKTLDEATGKLLDNDKSPSRRTGELDNR
GSHFYLSLYWAEALAAQNEDAELKAKFAPLAKALAENEQKIVAELAQVQGKPADIGGYYA
VDPAKVSAVMRPSATFNAALSTVQA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgaaaagtcaaccatcatttacacactgactgacgaggcgccattattggcg
acttattcgctactgccgatcattgagacctttactaagccagctggtatcgagattgtt
aaaagtgacatctctgtagctgcacgtgtgctcgcagaattcgctgactacctaagtgaa
gagcaaaaggtatccgacaaccttgctgagctaggtcgtcttacacaagatccagatact
aacattatcaaactcccaaatattagtgcctctgttgcgcaattgacagcatgtattaaa
gaacttcaatctaaaggttatgccattcctgactatccggaaaacccagcgactgaagaa
gaaaaaacaatcaaagctcgttatggcaaatgcctaggttcagcagtaaaccctgttctt
cgtgaaggtaactctgaccgtcgtgctcctgctgccgttaaaaattacgctaagaaacac
cctcactcaatgagcgagtggaaacaatggtcgcaaactcacgtttcacacatggaagaa
ggtgacttctatcacggtgaaaagtcaatgacacttgaccgtccacgcaatgtaaaaatg
gaacttatcacaaacagtggtaagagcattgttcttaagccaaaagttgcgcttcaagaa
ggcgaaatcattgactcaatgttcatgagcaaaaaagcgctttgcgacttctatgagaaa
caacttgatgactgccgtgaagcaggaattttattctcattacacgtaaaagcgacaatg
atgaaagtttcacacccgatcgttttcggtcactgtgtgaaaatctactataaagaagct
ttcgaaaaacacggtaagttgtttgacgaattaggtattaacgtaaataacggtatggct
gggttatacgagaaaatcgaaactcttccaacctcattacgtgaagaaatcattgaagat
ttacatgcttgccaagaacaccgtcctgcacttgcgatggttgactcagcaaaaggcatc
actaacttccattcacctaacgacatcatcgtagatgcttctatgcctgcaatgatccgt
gctggtggtaaaatgtggggtgctgatggtaagcaatacgatgctaaagcagtaatgcca
gaatcaacatttgcccgtatttaccaagaaatgatcaatttctgtaaatggcatggtaac
tttgatccaaaaacaatgggtacagtaccaaacgttggtttgatggctcaaaaagctgaa
gaatacggttctcacgacaagacttttgaaattcctgaagcaggtattgcaaacattact
gatcttgacactggtgaagtgttattgactcaaaatgttgaagaaggagatatctggcgt
atgtgtcaggtgaaagacgctccgattcgtgactgggtaaaacttgcagtaactcgtgca
cgtaactcaggcatgcctgcgatcttctggcttgacccatatcgtccacacgaaaatgaa
ttgatcaagaaagtacagaagtacttaaaagatcacgatacgactggtcttgatatccag
atcatgtctcaagtacgtgcaatgcgttacacacttgagcgtgtagttcgtggcctcgat
acaatttctgtaactggtaacatcttacgcgactacttaactgacttgttcccaattatg
gaacttggtacttctgcgaaaatgttgtctatcgttccgcttatggcgggtggtggcatg
tacgaaactggtgcgggtggttcagcacctaaacacgtacaacaacttgttgaagaaaac
cacttacgttgggattcgcttggtgagttccttgcgcttgcagtttctctagaagaaatg
ggtattaaagaaaataatgctcgtgcgaagttacttgcgaagacacttgatgaagcgact
ggtaaattgcttgacaatgacaagtctccatcacgtcgtacaggcgaacttgacaaccgt
ggcagtcacttctacttgtcactttactgggcagaagcacttgctgcacagaacgaagat
gctgagttgaaagctaaatttgctccacttgcaaaagcattagctgaaaacgaacagaag
atcgttgctgagcttgctcaagtacaaggtaaaccagctgatatcggtggttactatgca
gttgacccagcgaaagtaagcgctgtaatgcgtccaagtgctacattcaatgcagcgctt
tcaactgttcaggcttaa

DBGET integrated database retrieval system