KEGG   Acinetobacter baumannii ZW85-1: P795_8710Help
Entry
P795_8710         CDS       T02954                                 

Definition
(GenBank) dehydrogenase
  KO
K03366  meso-butanediol dehydrogenase / (S,S)-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.- 1.1.1.76 1.1.1.304]
Organism
abaz  Acinetobacter baumannii ZW85-1
Pathway
abaz00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:abaz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    P795_8710
Enzymes [BR:abaz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.76  (S,S)-butanediol dehydrogenase
     P795_8710
    1.1.1.304  diacetyl reductase [(S)-acetoin forming]
     P795_8710
    1.1.1.-  
     P795_8710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Polysacc_synt_2 3HCDH_N Methyltransf_31 Epimerase WcbI Methyltransf_25 Methyltr_RsmB-F Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AHB91467
LinkDB All DBs
Position
complement(1910032..1910817)
Genome map
AA seq 261 aa AA seqDB search
MVKGLKNKVALVTGAAQGIGRGIALRLAQEGAHIALVDMKQDRLNDVQQEIQALGVNAST
FIADVSDREQVYAAINHAEQTLGGFDVMINNAGIAQVQAIADITPDEFQKIVDINIGGVL
WGIQAAAAKFKQREHKGKIINACSIAGHDGFALLGIYSATKFAVRALTQAAAKEYASHGI
TVNGYCPGIVGTDMWVEIDKRFAEITGAAIGETYKKYVEGIALGRAQTPDDVAALVAFLA
SEDSDYITGQSILTDGGIVYR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggttaagggattaaaaaataaagtcgctttagtgactggggcagcccaaggcattggc
cgtgggattgccctgcgcttggcgcaagaaggggcacatattgcattagttgatatgaaa
caagatcgactgaacgatgtgcagcaggaaattcaagctttaggtgtaaatgcgagcaca
tttattgctgatgtaagtgaccgcgagcaagtgtatgctgctataaatcatgctgagcag
acacttggtgggtttgatgtcatgatcaataacgctggaattgcacaagttcaagcgatt
gctgatatcacacctgatgaattccaaaaaattgttgatattaatattggtggagtgctg
tggggaatacaggctgctgctgcaaaatttaaacaacgcgaacataaaggtaaaatcatt
aatgcttgctcaattgcaggccacgacgggtttgctttactcggtatttactcggcaacc
aaatttgcggtacgagcacttacccaagctgcggcaaaagaatatgccagtcacggtatt
acggtaaatggatattgtcccggaattgtcggaactgatatgtgggttgaaattgataaa
cgttttgctgaaattaccggtgccgctataggtgaaacttataaaaaatatgtggaaggc
attgctttaggtagagcccaaacaccagatgatgtagctgcattagttgcttttctggca
agtgaagattcggactatataacgggtcaatccattttaacggacggcggaattgtctat
cgctaa

DBGET integrated database retrieval system