KEGG   Acinetobacter baumannii ZW85-1: P795_8720Help
Entry
P795_8720         CDS       T02954                                 

Definition
(GenBank) putative pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
abaz  Acinetobacter baumannii ZW85-1
Pathway
abaz00010  Glycolysis / Gluconeogenesis
abaz00020  Citrate cycle (TCA cycle)
abaz00620  Pyruvate metabolism
abaz01100  Metabolic pathways
abaz01110  Biosynthesis of secondary metabolites
abaz01120  Microbial metabolism in diverse environments
abaz01130  Biosynthesis of antibiotics
abaz01200  Carbon metabolism
Module
abaz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abaz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P795_8720
   00020 Citrate cycle (TCA cycle)
    P795_8720
   00620 Pyruvate metabolism
    P795_8720
Enzymes [BR:abaz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     P795_8720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AHB91469
LinkDB All DBs
Position
complement(1912258..1913748)
Genome map
AA seq 496 aa AA seqDB search
MEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGDTLPVGGLI
AVCADSEVSDAEIEKFIASLGGSAAQAPEAPSEQSKAETSAPVAEKTEQPQTVAASASAP
AKVAKEDYAVPESLQGYQTSNELFATPHALKLAEKHNVNLAKVTGSGREGRISVQDIQKA
VQAAGGQWPDIKQQTQAKVVKSTADDSQVLATPVARRLAKQWGINLNDCRVSGTRGRVCK
EDVEAVYYRNNPTPVNEQPLQCATQPQSTVTTVAMNGMRKAIASRLQAAKRNAPHFRLVV
DLNVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQA
DISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQPDEFQGGSFSISNLG
MLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKF
LASFKQFVENPALILV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaggcacgatcgcccaatggttgattaaagagggtgatagctttaataaaggc
gatgaaatttgtgaaattgaaaccacaaaaatcgtcaatgtgttagaagcgccttttgct
ggaacgctccgtaaaattttagcgaaagatggtgatactttacctgttggtggtcttatt
gccgtatgtgctgatagtgaagtttctgatgcagaaattgaaaagtttattgcatcacta
ggtggttcagcagctcaagccccggaagcaccttcggagcaaagtaaagcggaaacatct
gcacctgttgctgaaaaaacagaacaaccacagactgtagcagctagtgcttcagctcct
gcaaaggtagcgaaagaggactacgctgtaccagagtcattacaaggctatcaaacatct
aatgagttgtttgcaacgccgcatgcattaaagcttgcagaaaaacacaatgtaaacttg
gcaaaagtcacaggttctggtcgtgaaggacgtattagtgttcaagacatccagaaggct
gtacaggctgctggtggtcagtggcctgatattaagcagcaaactcaagctaaagtggtt
aaatctacggccgatgatagccaagttttagcaacgcctgtagcacgtcgtttagcaaag
cagtggggcattaacctaaatgattgccgtgtttcaggtactcgtggccgtgtctgtaaa
gaagatgttgaggcagtttactatcgtaataacccaacgccagtaaatgaacaacctttg
caatgtgcaactcaaccacaatcaaccgttacgacggtggcaatgaatggaatgcgtaaa
gcgattgcttcacggttacaggctgcaaaacgtaacgcaccgcatttccgcttagtggtc
gatctcaacgtagaggctttgcaaaaattacgtaagcagattaatgagactgttccacaa
gtgaaactttctattaatgacatgctaattaaggcagctgccgccgcactgattaaagta
cctgaggtgaatgttcaatttgatgaagcgactcaatcaattttacagttctctcaagcg
gacatttcggtagccgtagcgattccaaacggtttaattacacccattgtgaaagctgcg
aatcaaaaatcgttggcacaaatttccgatgacatgcgtgatttggcaactcgtgctaag
actggcaagttacaacctgacgagtttcagggaggcagctttagcatttcaaatttagga
atgttaggcattaaacagttcgatgccattattaacccaccgcaaggtgcaattatggca
ttaggtgcttcggaatctcgcgctgttgtcgaaaatggcaatgtagtggttcgtgagatt
gtcacagcgacgttgtcatgcgatcaccgagttattgatggcgcagttggggcgaaattc
ttggccagctttaagcagtttgttgaaaaccctgctttaattttggtgtag

DBGET integrated database retrieval system