KEGG   Acinetobacter baumannii ZW85-1: P795_8745Help
Entry
P795_8745         CDS       T02954                                 

Definition
(GenBank) pyrroloquinoline quinone biosynthesis protein C
Organism
abaz  Acinetobacter baumannii ZW85-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Haem_oxygenas_2 TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: AHB91474
LinkDB All DBs
Position
complement(1918485..1919237)
Genome map
AA seq 250 aa AA seqDB search
MTALNQYGMSLEITPHNGWSQRFWEDLLPVKERVSKHPFFTEMANGGLSLESFRYALLNF
YPLVAHFPSYMAGALAKATAFAEPGVTETRDWLIQNIKVEERHLQWYRDWARGFGLTVEQ
LDSVRPPASMNAVNHFLWNMSHRGNLAECLAATNLAIEWATGDWSIQVYKGIHAYTDHPE
VTIDKRSLAWLRAHAHYDDLHPYEAMELIKRLCNERPDWQQKAFHAAEEGLRYYELALDD
CYRVQLQASA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgactgctctaaatcaatatggaatgagtttagaaattacgccgcataatggatggtct
cagcggttttgggaggatcttttaccagtgaaggagcgggtgagtaaacatccgtttttt
actgaaatggccaatgggggattgagcctagaaagtttccgttatgctttacttaacttc
tatccattggtagcgcatttcccgtcatatatggctggtgcgttagctaaagcaactgct
tttgcagaacctggcgttactgaaacaagagattggttaattcaaaatattaaggtcgaa
gagcgccatttacagtggtatcgggattgggctagaggttttggattaacggtagaacaa
ctcgatagtgttcgtccgccagcttcgatgaatgcggtgaatcattttctttggaatatg
agtcatcgtggcaacttggctgaatgtctggcagcgaccaatttggctattgaatgggcg
acaggtgactggtctattcaagtctataaaggcatacacgcttatacggatcatccggaa
gttaccattgataagcgttctttagcctggttacgtgcacatgctcattatgatgattta
catccttatgaagccatggagctgattaaacgtttgtgtaatgaacgtcctgattggcag
caaaaagcatttcatgcggcggaagaagggctgcggtattatgaattagctttagacgat
tgctatagagtacagcttcaagcctctgcttga

DBGET integrated database retrieval system