KEGG   Acinetobacter baumannii AB307-0294: ABBFA_001791Help
Entry
ABBFA_001791      CDS       T00795                                 

Gene name
gutB
Definition
(GenBank) Sorbitol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
abb00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:abb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ABBFA_001791 (gutB)
Enzymes [BR:abb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ABBFA_001791 (gutB)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ABBFA_001791 (gutB)
    1.1.1.-  
     ABBFA_001791 (gutB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 Semialdhyde_dh FAD_binding_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ACJ56535
LinkDB All DBs
Position
complement(1924100..1925158)
Genome map
AA seq 352 aa AA seqDB search
MKAARFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPITMGHEFSGVVYAVGEGVDDIEIGQHVVVEPYIVADDVPTGPGDNYHLSKNMNF
IGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAFVRSGAKAGDIALVG
GAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVMKITNG
EGVDVAFECSSVNKVLDTLVAAVKPTGVIVIVSIWSHPASINVHSVVMKELDVRGTIAYV
NDHQETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVHP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcgcgtttttatgacagaggtgatattcgtattgaagatattcctgaacca
gaagtcactcctggcactgtaggcattaaggtagcttggtgtggaatctgtggtacagat
ttgcacgaatttatggaaggaccaatttttattccaccttgtggacatccgcatcctatt
tcaggtgaatctgcaccgattaccatgggacatgaattttcaggtgtggtttatgccgta
ggtgaaggtgttgatgatattgaaattggtcagcatgtcgtcgtagagccttatattgtg
gcggatgatgtaccgactggaccgggcgataattatcatctttccaaaaatatgaacttt
attggtttaggtggtcgtggtggtggtttatcggaaaaaatcgcggttaaacgccgttgg
gtgcatccaatttccaataaaattccactggatcaggcagccttaattgaacctttatcg
gttggtcatcatgctttcgtacgtagtggtgcaaaggctggtgatattgcactggttggc
ggtgcggggccaattggtttattgctttcggcaattttaaaagcgaaaggtcttaaggtc
atcattaccgaactaagtgccaaacgtaaagaaaaagccaaagagtcgggagttgcagat
tatattttagacccgtcagaagttgatgttgtttctgaggtcatgaaaattactaatgga
gagggtgtcgatgtcgcgtttgaatgtagtagcgttaacaaggtattagatactttggtt
gcggcagtgaaaccaacaggcgtcatagttatcgtttcgatttggagccatccagcatca
attaatgtgcatagtgtggtaatgaaagagctcgatgtaagaggcacaattgcctacgta
aatgaccatcaagaaaccattaaactggtcgaagaaggtaaaataaatctggaacctttt
attacccagcgcattcaacttgatgatttgatttcacaaggttttgaaaccttaattcat
aacaatgaatcagccgttaagattattgtacatccataa

DBGET integrated database retrieval system